(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE315

PENCW_10.PE315       Location/Qualifiers
FT   CDS             join(723538..723702,723843..724124)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824881"
FT                   /orf_name="Pc13g03150"
FT                   /product="Putative uncharacterized protein Pc13g03150 "
FT                   /protein_id="CAP91384.1"
FT                   /db_xref="UniParc:UPI0001830F7C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V2"
FT                   /transl_table=1
FT                   /translation="MPKAATLKTTPLMQKSPLKLKPPVGNLEMITQPLEPSKVPRKKEH
FT                   PGQQRDFKNTRCKLRRWPRESPEERGFAWLSHLVSGYGQGTVSAKKGLARLGSPSWVPT
FT                   GGYLSALELFWGWREIPPRFSVHQSGGCIIESGYCGVDGIWRTE"
     MPKAATLKTT PLMQKSPLKL KPPVGNLEMI TQPLEPSKVP RKKEHPGQQR DFKNTRCKLR        60
     RWPRESPEER GFAWLSHLVS GYGQGTVSAK KGLARLGSPS WVPTGGYLSA LELFWGWREI       120
     PPRFSVHQSG GCIIESGYCG VDGIWRTE                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page