(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE316

PENCW_10.PE316       Location/Qualifiers
FT   CDS             join(724299..724417,724513..724797,724894..724972,
FT                   725206..725272,725781..725894,725993..726087)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949875"
FT                   /orf_name="Pc13g03160"
FT                   /product="Putative uncharacterized protein Pc13g03160 "
FT                   /protein_id="CAP91385.1"
FT                   /db_xref="UniParc:UPI0001830F7D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V3"
FT                   /transl_table=1
FT                   /translation="MGPKIEPGKTAIYGDVAVDHRIREIGTQRQKNESMDRASMYVLRT
FT                   DPLILSFLSHGRVTFNIHTSGATPQRLVSVIKPIDLTLAPFSVFVIVRRCRVVVRAMLA
FT                   AVIELSLPYALELGIRVSWGAFFGDSGFDSGTRHVIKVFSRVSFHGPHPGWVHNKRQTL
FT                   VGEWDTISDHFDSLELNRADGDQSVLMHQDHSPDWLRTHPNAHPVLSDPSEITQPALAG
FT                   KCGVNDPSTCLLPDMVVTPARRLSHSLSAV"
     MGPKIEPGKT AIYGDVAVDH RIREIGTQRQ KNESMDRASM YVLRTDPLIL SFLSHGRVTF        60
     NIHTSGATPQ RLVSVIKPID LTLAPFSVFV IVRRCRVVVR AMLAAVIELS LPYALELGIR       120
     VSWGAFFGDS GFDSGTRHVI KVFSRVSFHG PHPGWVHNKR QTLVGEWDTI SDHFDSLELN       180
     RADGDQSVLM HQDHSPDWLR THPNAHPVLS DPSEITQPAL AGKCGVNDPS TCLLPDMVVT       240
     PARRLSHSLS AV                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page