(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE317

PENCW_10.PE317       Location/Qualifiers
FT   CDS             complement(727497..728456)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949876"
FT                   /orf_name="Pc13g03170"
FT                   /product="Pc13g03170 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91386.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI0001831045"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V4"
FT                   /transl_table=1
FT                   /translation="MPASHRRGPWVPEEDQLLTQLVREQGPNNWVRISQHMHYRSPKQC
FT                   RERFHQNLKPSLNREPISAEEGLMIERMVNEMGKRWAEIARRLGNRSDNAVKNWWNGSM
FT                   NRKKRGLSTPTTSRTYSGRIEAPYTRASAMSPSRSRFSSSSASSSRPSWTESIESAISE
FT                   QYSHSRRESLASSARQLSPIYTLPSINRPIETPLTSPAFSEASHATSCEPPSMVSDHNS
FT                   VCSSSPRTFPSPQLLPLPVDLRSQYEIRRPSVHVVEDSPSYPARSLESLSDMASAQRWM
FT                   GHQPTLASWHQPTDLPKSYIPKPEPVRDTRMGVNNLLN"
     MPASHRRGPW VPEEDQLLTQ LVREQGPNNW VRISQHMHYR SPKQCRERFH QNLKPSLNRE        60
     PISAEEGLMI ERMVNEMGKR WAEIARRLGN RSDNAVKNWW NGSMNRKKRG LSTPTTSRTY       120
     SGRIEAPYTR ASAMSPSRSR FSSSSASSSR PSWTESIESA ISEQYSHSRR ESLASSARQL       180
     SPIYTLPSIN RPIETPLTSP AFSEASHATS CEPPSMVSDH NSVCSSSPRT FPSPQLLPLP       240
     VDLRSQYEIR RPSVHVVEDS PSYPARSLES LSDMASAQRW MGHQPTLASW HQPTDLPKSY       300
     IPKPEPVRDT RMGVNNLLN                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page