(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE318

PENCW_10.PE318       Location/Qualifiers
FT   CDS             join(complement(738857..740544),complement(737464..738806),
FT                   complement(736196..737085),complement(735512..736138))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949877"
FT                   /orf_name="Pc13g03180"
FT                   /product="Pc13g03180 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91387.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001831046"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V5"
FT                   /transl_table=1
FT                   /translation="MYPTVAPFPSVQPHQRIHYNTDTLNQQMYDANDQLPVHNDPSKPP
FT                   FNTIPRSRIPLPHPVQRLDPRDGSGYSSSTNMAEHTLRRKTPNGTLAAGYDGTLGDTVQ
FT                   PPAPKHILVSPMESGQFIPPQQGMQSENWQPMDQSATKQMNFPPVFKNDPAGNTIQGEV
FT                   VQDVNGTSWVRPVNYPPGVDSMLNQTLPLQPSQRYLLQNGQYVPTVLPATLQSCLGPTA
FT                   SAGTGPFGPYWPDGVYIPYRPAAFRDARFESPSPFTKQMSQPFYDLNQPTFNQAQVPLG
FT                   SHTDSGVAWGQSMPGLPTQDSLMKPLFPPRHSDQLPFHTRANRPLSGHPPPQSLNNEPT
FT                   NWSSRPLHGFQTPGPAVVVNADFKEKVLSEAHGVYVDLLATIHQARRNSVSNAAVDGYP
FT                   RFLKPSIYPKPPRQPGLDFSQAPPPDLTRHNSYPASQYDLQRQKFNAGSLRSNDPTSIP
FT                   RVQTRRPSLNQFAHSRGSDTHMLGLRDTGCPSGVSPFTRARGSLFNEGSPMSNAASALS
FT                   MLSDLCAESRWEWIDGMLLGGCLAYGLGDYHKAVRWYSRIITRDSTHVEAISNLAATML
FT                   ALDRREEASQHWLRAVQLRPSFFEAVEHLIGLLCNSHRGREAVNIIDFVQTSLRHPKDG
FT                   DCFKTDEHASEPESDAESNVSDACMYDKASFEYEDDMGQTQGIEPSSPDAKPLGFASSG
FT                   YAISGAENGRMLALVHAKGNMLYALGDNAGAAAAFEDAVLIAAGRRRHGIQSIIKQIFA
FT                   AFSSGPSNGYPQPEHDSKESILLYPDAALKTAKLVFPASGMPPGLQYVAEGISRNAATS
FT                   TTSNSLLSLAKIYQDGMSSVGSSGATRSSPGVRDILALYYLSLSLQPSPSTANNVGILL
FT                   AGIQNNPPARGSVRSNGETQHHLEIPGVVPGSGISLALAYYNYGLHLDSRHAHLYTNLG
FT                   SLLKDIGQLHAAIKMYEQAVQCDGNFDIALANLANAVKDSGKVNDAIVYYKRAVKVNPE
FT                   FAEAVCGLANALNSVCNWVGRDYPLSKYRRPQLPGALSAPNAPTVLPFHTFTCPLTAKQ
FT                   IRQISQRNGLRISTSTLRLPWLPATVFPPPSPPSPYLRVGYVSSDFNNHPLAHLMQSVF
FT                   GLHDPSRVKSYCYATTPSDKSVHRQQIEKEAPVFYDASGWSVDRLVQQIVGDGIHILVN
FT                   LNGYTRGARNEVFAARPAPIHMSFMGFAGTLGAEWCDYILADELSIPPETLSPGRRKTR
FT                   IGDRLLEEDNGEEVEDWVYGEKIVFTRDTFFCCDHRQSAPDASEKHVSWEEEQARRWRM
FT                   RKELFPKLSDDTIILGNFNQLYKVEPTTFRTWLRILARIPNAVLWLLRFPDTGEQNLRD
FT                   IAKAWAGEETASRIIFTDVAPKNTHIARAKILDLFLDTPECNAHTTATDVLWSGTPLLT
FT                   LPRYKYKMCSRMASSILSSALPSSEAGQRAREELIASSDEDYENKAIRLCLDLQYSGHE
FT                   GYARGRLTDIRQMLFRDRYKNKLFDTARWVRDLETAYEAVWAQWVNGEEGDIWL"
     MYPTVAPFPS VQPHQRIHYN TDTLNQQMYD ANDQLPVHND PSKPPFNTIP RSRIPLPHPV        60
     QRLDPRDGSG YSSSTNMAEH TLRRKTPNGT LAAGYDGTLG DTVQPPAPKH ILVSPMESGQ       120
     FIPPQQGMQS ENWQPMDQSA TKQMNFPPVF KNDPAGNTIQ GEVVQDVNGT SWVRPVNYPP       180
     GVDSMLNQTL PLQPSQRYLL QNGQYVPTVL PATLQSCLGP TASAGTGPFG PYWPDGVYIP       240
     YRPAAFRDAR FESPSPFTKQ MSQPFYDLNQ PTFNQAQVPL GSHTDSGVAW GQSMPGLPTQ       300
     DSLMKPLFPP RHSDQLPFHT RANRPLSGHP PPQSLNNEPT NWSSRPLHGF QTPGPAVVVN       360
     ADFKEKVLSE AHGVYVDLLA TIHQARRNSV SNAAVDGYPR FLKPSIYPKP PRQPGLDFSQ       420
     APPPDLTRHN SYPASQYDLQ RQKFNAGSLR SNDPTSIPRV QTRRPSLNQF AHSRGSDTHM       480
     LGLRDTGCPS GVSPFTRARG SLFNEGSPMS NAASALSMLS DLCAESRWEW IDGMLLGGCL       540
     AYGLGDYHKA VRWYSRIITR DSTHVEAISN LAATMLALDR REEASQHWLR AVQLRPSFFE       600
     AVEHLIGLLC NSHRGREAVN IIDFVQTSLR HPKDGDCFKT DEHASEPESD AESNVSDACM       660
     YDKASFEYED DMGQTQGIEP SSPDAKPLGF ASSGYAISGA ENGRMLALVH AKGNMLYALG       720
     DNAGAAAAFE DAVLIAAGRR RHGIQSIIKQ IFAAFSSGPS NGYPQPEHDS KESILLYPDA       780
     ALKTAKLVFP ASGMPPGLQY VAEGISRNAA TSTTSNSLLS LAKIYQDGMS SVGSSGATRS       840
     SPGVRDILAL YYLSLSLQPS PSTANNVGIL LAGIQNNPPA RGSVRSNGET QHHLEIPGVV       900
     PGSGISLALA YYNYGLHLDS RHAHLYTNLG SLLKDIGQLH AAIKMYEQAV QCDGNFDIAL       960
     ANLANAVKDS GKVNDAIVYY KRAVKVNPEF AEAVCGLANA LNSVCNWVGR DYPLSKYRRP      1020
     QLPGALSAPN APTVLPFHTF TCPLTAKQIR QISQRNGLRI STSTLRLPWL PATVFPPPSP      1080
     PSPYLRVGYV SSDFNNHPLA HLMQSVFGLH DPSRVKSYCY ATTPSDKSVH RQQIEKEAPV      1140
     FYDASGWSVD RLVQQIVGDG IHILVNLNGY TRGARNEVFA ARPAPIHMSF MGFAGTLGAE      1200
     WCDYILADEL SIPPETLSPG RRKTRIGDRL LEEDNGEEVE DWVYGEKIVF TRDTFFCCDH      1260
     RQSAPDASEK HVSWEEEQAR RWRMRKELFP KLSDDTIILG NFNQLYKVEP TTFRTWLRIL      1320
     ARIPNAVLWL LRFPDTGEQN LRDIAKAWAG EETASRIIFT DVAPKNTHIA RAKILDLFLD      1380
     TPECNAHTTA TDVLWSGTPL LTLPRYKYKM CSRMASSILS SALPSSEAGQ RAREELIASS      1440
     DEDYENKAIR LCLDLQYSGH EGYARGRLTD IRQMLFRDRY KNKLFDTARW VRDLETAYEA      1500
     VWAQWVNGEE GDIWL                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page