(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE32

PENCW_10.PE32        Location/Qualifiers
FT   CDS             73662..74771
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824589"
FT                   /orf_name="Pc13g00320"
FT                   /product="Putative uncharacterized protein Pc13g00320 "
FT                   /protein_id="CAP91101.1"
FT                   /db_xref="UniParc:UPI0001830DC5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H178"
FT                   /transl_table=1
FT                   /translation="MVCLARFERAWLLRSLYSQSQRTLSNTVTTSDVKAPKATSFLQST
FT                   TLYPSSPTAQSWTSPLRSFPPETDIDTPTLTYPGTHTTTSEKENGIIEYLKVDDELGGS
FT                   GLIVEEQSSRTLLPFSLVEDEFAKAANGGARLSQYTVSSVDSDHDFTGSSEFVVYVPSD
FT                   QATLHQPAEVTSMKSSSSTGVFQSLSGQTSVGFSNRGTLPGTLGAVSRSKQKEIGSYVT
FT                   VNLEYSSHLFGNSRHHQPTQTTRNPPKFDDLDLSTLNPITKSQPMDSTKTVPATTTATK
FT                   NTVEQLGTDGSDASRVLSSHGVAVILGSISGASLLFAIIFYLHRFYFRRISTSSRGTGS
FT                   VTQPKADNPAATCPDMSEILEISRFSADS"
     MVCLARFERA WLLRSLYSQS QRTLSNTVTT SDVKAPKATS FLQSTTLYPS SPTAQSWTSP        60
     LRSFPPETDI DTPTLTYPGT HTTTSEKENG IIEYLKVDDE LGGSGLIVEE QSSRTLLPFS       120
     LVEDEFAKAA NGGARLSQYT VSSVDSDHDF TGSSEFVVYV PSDQATLHQP AEVTSMKSSS       180
     STGVFQSLSG QTSVGFSNRG TLPGTLGAVS RSKQKEIGSY VTVNLEYSSH LFGNSRHHQP       240
     TQTTRNPPKF DDLDLSTLNP ITKSQPMDST KTVPATTTAT KNTVEQLGTD GSDASRVLSS       300
     HGVAVILGSI SGASLLFAII FYLHRFYFRR ISTSSRGTGS VTQPKADNPA ATCPDMSEIL       360
     EISRFSADS                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page