(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE322

PENCW_10.PE322       Location/Qualifiers
FT   CDS             join(750313..750484,750554..751146)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950857"
FT                   /orf_name="Pc13g03220"
FT                   /product="Pc13g03220 protein"
FT                   /function="ATP binding"
FT                   /function="adenylate kinase activity"
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91391.1"
FT                   /db_xref="GO:0004017"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="UniParc:UPI000183104A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V9"
FT                   /transl_table=1
FT                   /translation="MSHTTKQLRKAARIILIGAPGVGKGTQSERLLARFPQLVSISSGD
FT                   LLRENVRRRTPLGLEAEAAMQSGNLVPDSMILNLISDDMKSKGWLLPPRTSSVQPTASS
FT                   SSSSLADTSSSHSIDSSASFILDGFPRTATQAATLDSLVPVNFVVHLITPPSVILARIA
FT                   SRWVHEPSGRVYNTDFHPPKVPGKDDVTGEPLTQREDDSLETWKQRLRKFEETSKSLLE
FT                   HYDRQRCLFRAEGNSSDEISPKLFAEVERRFC"
     MSHTTKQLRK AARIILIGAP GVGKGTQSER LLARFPQLVS ISSGDLLREN VRRRTPLGLE        60
     AEAAMQSGNL VPDSMILNLI SDDMKSKGWL LPPRTSSVQP TASSSSSSLA DTSSSHSIDS       120
     SASFILDGFP RTATQAATLD SLVPVNFVVH LITPPSVILA RIASRWVHEP SGRVYNTDFH       180
     PPKVPGKDDV TGEPLTQRED DSLETWKQRL RKFEETSKSL LEHYDRQRCL FRAEGNSSDE       240
     ISPKLFAEVE RRFC                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page