(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE323

PENCW_10.PE323       Location/Qualifiers
FT   CDS             join(complement(752077..752466),complement(751439..751927))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825153"
FT                   /orf_name="Pc13g03230"
FT                   /product="Pc13g03230 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91392.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="UniParc:UPI000183104B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W0"
FT                   /transl_table=1
FT                   /translation="MRWPPWSSESTNDEQKQTPSSWLSSAANKPSSILDWTAFTELRTI
FT                   IPTVVLTSGILIAVRFHRRYLRRIPDAPSISSSYLRRRSIFGQVTSVGDGDNFRIFHTP
FT                   GGRMAGWGWLPWKKVPTVKKDLKDKTIHIRLAGVDAPELAHFGRPEQPFARDAHTWLTS
FT                   YLSNRRVRALVHRQDQYSRVVASVFVRRAFDFPPFRRRDVSYEMLKRGLATVYEAKIGS
FT                   EFGGDKMEKKYRKAEWWAKKRARGLWKDYRRVGSGWESPREYKNRMGMGDPLPIEKGNG
FT                   KGNGKGKIGQK"
     MRWPPWSSES TNDEQKQTPS SWLSSAANKP SSILDWTAFT ELRTIIPTVV LTSGILIAVR        60
     FHRRYLRRIP DAPSISSSYL RRRSIFGQVT SVGDGDNFRI FHTPGGRMAG WGWLPWKKVP       120
     TVKKDLKDKT IHIRLAGVDA PELAHFGRPE QPFARDAHTW LTSYLSNRRV RALVHRQDQY       180
     SRVVASVFVR RAFDFPPFRR RDVSYEMLKR GLATVYEAKI GSEFGGDKME KKYRKAEWWA       240
     KKRARGLWKD YRRVGSGWES PREYKNRMGM GDPLPIEKGN GKGNGKGKIG QK               292
//

If you have problems or comments...

PBIL Back to PBIL home page