(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE324

PENCW_10.PE324       Location/Qualifiers
FT   CDS             752794..754293
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129519"
FT                   /orf_name="Pc13g03240"
FT                   /product="Pc13g03240 protein"
FT                   /protein_id="CAP91393.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000183104C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W1"
FT                   /transl_table=1
FT                   /translation="MTRPKESHGVAFLPRELFWMILGYLEPNELVRCRRVSRAWNEAFS
FT                   NPAVLLALLKKLFPWTDEVKSLGTETSVEEQDQGRRLFDQVASRYNYLARGKPRSIQKY
FT                   RLCDDFGSSGDREWYQVQPWESHASHMRRFVDRQFSEALWTFENGLLVYPSADHQCLVL
FT                   MDLETDRQFMVPFIIRGKVVRRVRLQKSLLVVEWAEPKAFHWLNDSDGVHRHFASSFDV
FT                   TRGENQGWSITPRNEWKIMFLGHPLSERDRFFSSHSNTHYVIYIWQPNRSLYTADEDAP
FT                   IESLFVWDISKVSSYRPSLDPTGRLRDDSPGDSPSIVARFGFRDLEFFDIRQRGCPSIQ
FT                   RLEITDDAQAVEITENVSIQPQDEPPEIFGLPEPITTSIPLVGNGPHWRRHFEGVLPPY
FT                   RGNCSMQAESMELNGCIMKDPWFGIISQVTVLEPNLGFCLHFDTWTWVQNQATYLSIQT
FT                   PRSTITCDNWDFVGRGKIAGSEKYLMGENCNRELVVYRFDR"
     MTRPKESHGV AFLPRELFWM ILGYLEPNEL VRCRRVSRAW NEAFSNPAVL LALLKKLFPW        60
     TDEVKSLGTE TSVEEQDQGR RLFDQVASRY NYLARGKPRS IQKYRLCDDF GSSGDREWYQ       120
     VQPWESHASH MRRFVDRQFS EALWTFENGL LVYPSADHQC LVLMDLETDR QFMVPFIIRG       180
     KVVRRVRLQK SLLVVEWAEP KAFHWLNDSD GVHRHFASSF DVTRGENQGW SITPRNEWKI       240
     MFLGHPLSER DRFFSSHSNT HYVIYIWQPN RSLYTADEDA PIESLFVWDI SKVSSYRPSL       300
     DPTGRLRDDS PGDSPSIVAR FGFRDLEFFD IRQRGCPSIQ RLEITDDAQA VEITENVSIQ       360
     PQDEPPEIFG LPEPITTSIP LVGNGPHWRR HFEGVLPPYR GNCSMQAESM ELNGCIMKDP       420
     WFGIISQVTV LEPNLGFCLH FDTWTWVQNQ ATYLSIQTPR STITCDNWDF VGRGKIAGSE       480
     KYLMGENCNR ELVVYRFDR                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page