(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE325

PENCW_10.PE325       Location/Qualifiers
FT   CDS             join(complement(757275..757433),complement(756042..757206),
FT                   complement(755901..755934),complement(755599..755821),
FT                   complement(755386..755454))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978318"
FT                   /orf_name="Pc13g03250"
FT                   /product="Pc13g03250 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP91394.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000183104D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W2"
FT                   /transl_table=1
FT                   /translation="MSTVTVATDAYAILGVERDAKLPDINIAYKRLALKLHPDKAGNSP
FT                   ATVERFRKIQDAVEVLRDEDRRRLLDEALKKKTKRHLDPEDDIPARVFKSNYNRSSKRE
FT                   HHTHDFKWSNPFAEPAWHHRQHTFSYYYSYGTSVHMDPESAESKAKRAQFEAENVQWEN
FT                   EWLGTDPEVQKARAELRKENMRARMKRDLADMAKGQDEDTKYADFDHVVEGVLDELNFG
FT                   HEDFVHVLPEENIKTCNPADTFDTFSYEYAKKSRSGADDPIHSDRASNPQSATGSDSSF
FT                   EFTTSSDSTSYTHSANGHSNFKSTVEDFESTTDNSESTTDDSNSDAEKLINSYMVGHDS
FT                   LLPVVSFLKQKLADPHGRYTLDDLGGELNGIMLEAYCGWLEEVRLSVPNASPVTVRNDP
FT                   KFCSHHGLWYKEFGRPVCNVCNLWMPTFILTCPGCGLNACVRYFPLVWISRCCRKKKKE
FT                   RGKAASITVDSAFAHSIDFNESRSRYHFVLMHRYSDLGLTSNSHRLLILSYVPSPLTGW
FT                   TPVFVLYLARIQDPDCHYDADVVELNPRKKYN"
     MSTVTVATDA YAILGVERDA KLPDINIAYK RLALKLHPDK AGNSPATVER FRKIQDAVEV        60
     LRDEDRRRLL DEALKKKTKR HLDPEDDIPA RVFKSNYNRS SKREHHTHDF KWSNPFAEPA       120
     WHHRQHTFSY YYSYGTSVHM DPESAESKAK RAQFEAENVQ WENEWLGTDP EVQKARAELR       180
     KENMRARMKR DLADMAKGQD EDTKYADFDH VVEGVLDELN FGHEDFVHVL PEENIKTCNP       240
     ADTFDTFSYE YAKKSRSGAD DPIHSDRASN PQSATGSDSS FEFTTSSDST SYTHSANGHS       300
     NFKSTVEDFE STTDNSESTT DDSNSDAEKL INSYMVGHDS LLPVVSFLKQ KLADPHGRYT       360
     LDDLGGELNG IMLEAYCGWL EEVRLSVPNA SPVTVRNDPK FCSHHGLWYK EFGRPVCNVC       420
     NLWMPTFILT CPGCGLNACV RYFPLVWISR CCRKKKKERG KAASITVDSA FAHSIDFNES       480
     RSRYHFVLMH RYSDLGLTSN SHRLLILSYV PSPLTGWTPV FVLYLARIQD PDCHYDADVV       540
     ELNPRKKYN                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page