(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE326

PENCW_10.PE326       Location/Qualifiers
FT   CDS             join(complement(759468..759523),complement(758753..759327),
FT                   complement(758528..758696),complement(758380..758473))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000215911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950858"
FT                   /orf_name="Pc13g03260"
FT                   /product="Pc13g03260 protein"
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAP91395.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="UniParc:UPI000183104E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W3"
FT                   /transl_table=1
FT                   /translation="MFSRAVRPALRAGGAAVARPAPANAATFATLREIEGRLKSIKNIE
FT                   KITNTMKIVASTRLTRAQKAMDESRVYGKTSNTVFEQAETKPLEDKKVLLVVASSDKGL
FT                   CGGIHSGLSKATRRILADTPNADVAILGEKAKATLSRLAPEHIVLSFANVCKDIPTFAD
FT                   AQAIADQIALLPEDYASVRIIYNSFVNAQSYEPVTIEAYSEEAITQSANISSYEVDDEV
FT                   LTSLREYALANNLYWAMAEGHACEISARRNAMENASKNAGEMINKFQILYNRQRQATIT
FT                   GELVEIITGATASEDM"
     MFSRAVRPAL RAGGAAVARP APANAATFAT LREIEGRLKS IKNIEKITNT MKIVASTRLT        60
     RAQKAMDESR VYGKTSNTVF EQAETKPLED KKVLLVVASS DKGLCGGIHS GLSKATRRIL       120
     ADTPNADVAI LGEKAKATLS RLAPEHIVLS FANVCKDIPT FADAQAIADQ IALLPEDYAS       180
     VRIIYNSFVN AQSYEPVTIE AYSEEAITQS ANISSYEVDD EVLTSLREYA LANNLYWAMA       240
     EGHACEISAR RNAMENASKN AGEMINKFQI LYNRQRQATI TGELVEIITG ATASEDM          297
//

If you have problems or comments...

PBIL Back to PBIL home page