(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE328

PENCW_10.PE328       Location/Qualifiers
FT   CDS             join(complement(765624..765669),complement(765405..765566),
FT                   complement(764418..765334))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978320"
FT                   /orf_name="Pc13g03280"
FT                   /product="Pc13g03280 protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP91397.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831050"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W5"
FT                   /transl_table=1
FT                   /translation="MADAKKPAVLIVGGLGFIGRHLALYIHENNLASEVRLVDKVLPQL
FT                   AWLAPEFEEACSKDKFVQADASREQHFPRIFDRANGEQFDYVINCGGESRHSQPDDVYE
FT                   VRSYALSVALGKEIARRGIPAFIETSTAHVYKGGSTPRKETDKLAPWHKLAAWKLKAAE
FT                   ELLKVPNLQYCALRLPHVYGAYDPGYFATGICLSAVHVDLKQDLEFLHTKDLKINTLHV
FT                   KDAASALFEAAKWRAAKGFIDPKEGVVTFNVVDHNDTKQEHVANALTEVFGLKVSFIGS
FT                   LASQLAKLNLDDVLDDMNEVGLQTWAELVERANITRPGPISPFLERDIVRDQDMSIDGS
FT                   KFENETGWKPSYPNFGADSIREIVDSYKRMGWWP"
     MADAKKPAVL IVGGLGFIGR HLALYIHENN LASEVRLVDK VLPQLAWLAP EFEEACSKDK        60
     FVQADASREQ HFPRIFDRAN GEQFDYVINC GGESRHSQPD DVYEVRSYAL SVALGKEIAR       120
     RGIPAFIETS TAHVYKGGST PRKETDKLAP WHKLAAWKLK AAEELLKVPN LQYCALRLPH       180
     VYGAYDPGYF ATGICLSAVH VDLKQDLEFL HTKDLKINTL HVKDAASALF EAAKWRAAKG       240
     FIDPKEGVVT FNVVDHNDTK QEHVANALTE VFGLKVSFIG SLASQLAKLN LDDVLDDMNE       300
     VGLQTWAELV ERANITRPGP ISPFLERDIV RDQDMSIDGS KFENETGWKP SYPNFGADSI       360
     REIVDSYKRM GWWP                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page