(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE329

PENCW_10.PE329       Location/Qualifiers
FT   CDS             join(766436..766624,766744..766835,766931..767018,
FT                   767108..767185,767291..767461,767565..767630)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950859"
FT                   /orf_name="Pc13g03290"
FT                   /product="Putative uncharacterized protein Pc13g03290 "
FT                   /protein_id="CAP91398.1"
FT                   /db_xref="UniParc:UPI0001831051"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W6"
FT                   /transl_table=1
FT                   /translation="MGYSEGSGCKDPRTGLQALHPIQKDGEGWDKGGALVGGPRAILRA
FT                   RHTIERRGNRQKTMSGLSSLVISGTFKSPYTDGYISSISSPGLYEPGGRMSGCGYSKAM
FT                   QPLSWSAIYQGCRHDQANFLQAGLYSPIFHFSLMGSGKVAVDGPWSHSSGGWLDWLNNE
FT                   QTIGTDTRGNIHWVTEGYLCKKNEKLAQRARVSASGGSGELRKSSTGLHPDPIRFPVYW
FT                   TIGDM"
     MGYSEGSGCK DPRTGLQALH PIQKDGEGWD KGGALVGGPR AILRARHTIE RRGNRQKTMS        60
     GLSSLVISGT FKSPYTDGYI SSISSPGLYE PGGRMSGCGY SKAMQPLSWS AIYQGCRHDQ       120
     ANFLQAGLYS PIFHFSLMGS GKVAVDGPWS HSSGGWLDWL NNEQTIGTDT RGNIHWVTEG       180
     YLCKKNEKLA QRARVSASGG SGELRKSSTG LHPDPIRFPV YWTIGDM                     227
//

If you have problems or comments...

PBIL Back to PBIL home page