(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE330

PENCW_10.PE330       Location/Qualifiers
FT   CDS             join(complement(769716..769875),complement(769376..769661),
FT                   complement(768198..769323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825154"
FT                   /orf_name="Pc13g03300"
FT                   /product="Pc13g03300 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91399.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001830442"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W7"
FT                   /transl_table=1
FT                   /translation="MAIEDDEKNDQHGTDIASTVSADIVPIDMSEHGTMKRALKPRHSQ
FT                   MIALGGCVGTGLFVGTGATLALGGPAFLLTAFIVLIFLVYIIVTAIVEMVAYLPVGGAS
FT                   LSYYGTRYVSKSLGFAMGWLYVYSLGILVPYEITAGALVIDYWDSPVNVAVWITVFMVL
FT                   IVGLNLLPVEYYGESEFWFSTIKVFTIIGLLVLSIVLFWGGGPKQSGILGFHYWKDPGP
FT                   INTWLADGAGGRLVAFVRTLVLSAFPFTFSPELLIATSGEMQNPRKDLGKAANRFVIRL
FT                   IVFYLGTVLAIGVICPSNDEDLVSSGSNAKASAFVVGIKHAGIHGLGSVVNAAILTTAW
FT                   SAGNAYLYMSSRALYALAISGQAPKIFLRCTNRGVPYAAVLACSSFGVLAYLNCASSSS
FT                   TVFTWFVNITNTSAFISWVCCCIVYLRFRSAYNTQGKPELPYRSWTQPYGAWFALFFFL
FT                   LLTLINGFNVFFPGQLSASSFFTAYIGIPAFMVTYAGHKLLKGRSDPLWITSDEINIWD
FT                   GLENIH"
     MAIEDDEKND QHGTDIASTV SADIVPIDMS EHGTMKRALK PRHSQMIALG GCVGTGLFVG        60
     TGATLALGGP AFLLTAFIVL IFLVYIIVTA IVEMVAYLPV GGASLSYYGT RYVSKSLGFA       120
     MGWLYVYSLG ILVPYEITAG ALVIDYWDSP VNVAVWITVF MVLIVGLNLL PVEYYGESEF       180
     WFSTIKVFTI IGLLVLSIVL FWGGGPKQSG ILGFHYWKDP GPINTWLADG AGGRLVAFVR       240
     TLVLSAFPFT FSPELLIATS GEMQNPRKDL GKAANRFVIR LIVFYLGTVL AIGVICPSND       300
     EDLVSSGSNA KASAFVVGIK HAGIHGLGSV VNAAILTTAW SAGNAYLYMS SRALYALAIS       360
     GQAPKIFLRC TNRGVPYAAV LACSSFGVLA YLNCASSSST VFTWFVNITN TSAFISWVCC       420
     CIVYLRFRSA YNTQGKPELP YRSWTQPYGA WFALFFFLLL TLINGFNVFF PGQLSASSFF       480
     TAYIGIPAFM VTYAGHKLLK GRSDPLWITS DEINIWDGLE NIH                         523
//

If you have problems or comments...

PBIL Back to PBIL home page