(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE331

PENCW_10.PE331       Location/Qualifiers
FT   CDS             770662..772047
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950860"
FT                   /orf_name="Pc13g03310"
FT                   /product="Pc13g03310 protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="cellular process"
FT                   /protein_id="CAP91400.1"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="UniParc:UPI0001830443"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W8"
FT                   /transl_table=1
FT                   /translation="MAILKKPQPFKKALHFSEKEFEERQQRALKLMKQEGLDGFLITKQ
FT                   ETLYYLTGYDTFGYVFFQAMYFHKDGSKKLVTRMPDLRQALYTSVLTYNDIMIRSDDAD
FT                   SNPVSLVPLVLKEFGINSSSKRIGYEPNSATLTLEVGKLLEESVAGLCTLVNHSNLFTR
FT                   ELRIVKSPAELRKIRKAAYLADFALIRTLKLAKPGAYEGDLWREIVGTVYEGGGDDPAN
FT                   ENILVSGNKAVLTRYSAGKSTIERQLTLEHAGVYKHYHACLMRTVHIGGVTALARRMFE
FT                   VNILQMEAAMAALKPGCAIEEVFEAYARVADENGFKDQRFNACGYSLGATFAPTWMDFP
FT                   MFVRGQKVIAQPGMVFFIHIILMDKATDTASSIGQTVEVTQDGCVSLSKLPFHITRKQT
FT                   IAAWKKVKKEDYGFTAEEEDKGENLRDVELSDGDVDAEDYDVEYDFSEYQPSAPPGDPT
FT                   QLV"
     MAILKKPQPF KKALHFSEKE FEERQQRALK LMKQEGLDGF LITKQETLYY LTGYDTFGYV        60
     FFQAMYFHKD GSKKLVTRMP DLRQALYTSV LTYNDIMIRS DDADSNPVSL VPLVLKEFGI       120
     NSSSKRIGYE PNSATLTLEV GKLLEESVAG LCTLVNHSNL FTRELRIVKS PAELRKIRKA       180
     AYLADFALIR TLKLAKPGAY EGDLWREIVG TVYEGGGDDP ANENILVSGN KAVLTRYSAG       240
     KSTIERQLTL EHAGVYKHYH ACLMRTVHIG GVTALARRMF EVNILQMEAA MAALKPGCAI       300
     EEVFEAYARV ADENGFKDQR FNACGYSLGA TFAPTWMDFP MFVRGQKVIA QPGMVFFIHI       360
     ILMDKATDTA SSIGQTVEVT QDGCVSLSKL PFHITRKQTI AAWKKVKKED YGFTAEEEDK       420
     GENLRDVELS DGDVDAEDYD VEYDFSEYQP SAPPGDPTQL V                           461
//

If you have problems or comments...

PBIL Back to PBIL home page