(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE332

PENCW_10.PE332       Location/Qualifiers
FT   CDS             complement(772327..773511)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000243774" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978321"
FT                   /orf_name="Pc13g03320"
FT                   /product="Pc13g03320 protein"
FT                   /EC_number="4.3.1.19"
FT                   /function="L-threonine ammonia-lyase activity"
FT                   /function="metal ion binding"
FT                   /function="metallopeptidase activity"
FT                   /function="succinyl-diaminopimelate desuccinylase activity "
FT                   /biological_process="lysine biosynthetic process "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP91401.1"
FT                   /db_xref="GO:0004794"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0009014"
FT                   /db_xref="GO:0009085"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniParc:UPI0001830444"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W9"
FT                   /transl_table=1
FT                   /translation="MDGLQYTTKHDVTIDDVVSLTQTMVQIDSSTPGSGSNTAGETTVA
FT                   QYICAWLQHRNIECHWIEETPGRPSVIGVVRGSGDGKSLMFNGHTDTVTLQGYDGDPLS
FT                   GHIANGRLYGRGSADMKSGMAAAMIATASAAKLNLRGDVILAAVADEECDSIGTEQVLA
FT                   AGWRADAAIVAEPTDFAIINAHKGYVLLEVDIHGIAAHGSRPDLGVDAICKAGYFLVEL
FT                   DRYSQSLPQRSPTGVEIDAPNVHVGIIRGGAEINSYPAKCTISIERRTVAGETATSVEN
FT                   ELRPILQKLASTVSDFTFELRTTCYRPPYSIASDHPFVNLVVEHAVKSTGMAPPIKSET
FT                   YWTDMALLSEAGIPGVIWGPKGCGLHSKEESVEVESIRQLADSFIAIAASYCQG"
     MDGLQYTTKH DVTIDDVVSL TQTMVQIDSS TPGSGSNTAG ETTVAQYICA WLQHRNIECH        60
     WIEETPGRPS VIGVVRGSGD GKSLMFNGHT DTVTLQGYDG DPLSGHIANG RLYGRGSADM       120
     KSGMAAAMIA TASAAKLNLR GDVILAAVAD EECDSIGTEQ VLAAGWRADA AIVAEPTDFA       180
     IINAHKGYVL LEVDIHGIAA HGSRPDLGVD AICKAGYFLV ELDRYSQSLP QRSPTGVEID       240
     APNVHVGIIR GGAEINSYPA KCTISIERRT VAGETATSVE NELRPILQKL ASTVSDFTFE       300
     LRTTCYRPPY SIASDHPFVN LVVEHAVKST GMAPPIKSET YWTDMALLSE AGIPGVIWGP       360
     KGCGLHSKEE SVEVESIRQL ADSFIAIAAS YCQG                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page