(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE334

PENCW_10.PE334       Location/Qualifiers
FT   CDS             join(complement(778085..778108),complement(777940..778027),
FT                   complement(776623..777867),complement(776417..776562))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672454"
FT                   /orf_name="Pc13g03340"
FT                   /product="Pc13g03340 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91403.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0001830446"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X1"
FT                   /transl_table=1
FT                   /translation="MSRALPFTLDTPSLLHKASLLDGNWVQSKSGQRFDVEDPGTGKAF
FT                   ASCPTNTVADVDAYIKSAQRSFLTYRATNPRERAKMLLNWHSLVTRSKNDIATLVVYET
FT                   GKPMAEALGEVEYALGFAWWFAGEAERIRGSIAQPSISDRRNLVIKQPIGVCVALVPWN
FT                   FPVAMIIRKAAAALAAGCTIVIKPSPETPLSVLALADLALQAGFPPGAMNVLSTDSAHT
FT                   PSVSEALCKHQLVRKVTFTGSTTVGQLIARHCSEGLKKVTLELGGNCPFIVFDDGDLDQ
FT                   ALAALMVLKWRTAGQACTHANRVYVQSGVYDRFLSMLVDATRRLRVGHGADPETTIGAL
FT                   TTKSGLVKLERHIADAVAKGGKIVLGGRPLEHLGGNFFQPTIISGMSSDMLTTQEEVFG
FT                   PLLGLYQFETEEEAVRLANDTNMGLASYFFTKDVSRTWRLLESLEAGMIGMNTGNSSAA
FT                   ESPFGGIKASGYGKEAGKEVAIEEYLIAKTGTLTVGAIASKL"
     MSRALPFTLD TPSLLHKASL LDGNWVQSKS GQRFDVEDPG TGKAFASCPT NTVADVDAYI        60
     KSAQRSFLTY RATNPRERAK MLLNWHSLVT RSKNDIATLV VYETGKPMAE ALGEVEYALG       120
     FAWWFAGEAE RIRGSIAQPS ISDRRNLVIK QPIGVCVALV PWNFPVAMII RKAAAALAAG       180
     CTIVIKPSPE TPLSVLALAD LALQAGFPPG AMNVLSTDSA HTPSVSEALC KHQLVRKVTF       240
     TGSTTVGQLI ARHCSEGLKK VTLELGGNCP FIVFDDGDLD QALAALMVLK WRTAGQACTH       300
     ANRVYVQSGV YDRFLSMLVD ATRRLRVGHG ADPETTIGAL TTKSGLVKLE RHIADAVAKG       360
     GKIVLGGRPL EHLGGNFFQP TIISGMSSDM LTTQEEVFGP LLGLYQFETE EEAVRLANDT       420
     NMGLASYFFT KDVSRTWRLL ESLEAGMIGM NTGNSSAAES PFGGIKASGY GKEAGKEVAI       480
     EEYLIAKTGT LTVGAIASKL                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page