(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE335

PENCW_10.PE335       Location/Qualifiers
FT   CDS             join(778711..778752,778832..779263,779315..780871)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000250947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950861"
FT                   /orf_name="Pc13g03350"
FT                   /product="Pc13g03350 protein"
FT                   /function="copper ion binding"
FT                   /function="primary amine oxidase activity"
FT                   /function="quinone binding"
FT                   /biological_process="amine metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91404.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008131"
FT                   /db_xref="GO:0009308"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR015802"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="UniParc:UPI0001830447"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y2"
FT                   /transl_table=1
FT                   /translation="MHPFDPLSPAEISEVTAIVRTHFPGQLPVFRFITLKEPAKLEMLP
FT                   FLENEHRGLPNITRPARTSRVQVVMRSDKGENQLIELLVDLDNKRVIKNEHLVGRHSYI
FT                   DADYMRLVESACLADPKVQDEIKKLKLPANSTVIVEPWAYGTDGINDMSERISMCWFYL
FT                   RLLDNPDANYYAYPLDLCAEVSEELKVTKIYYLPSSQEERISDQARPFDINRIHSTVDS
FT                   EYHPSLRPPPRNTTKPYQVVQPEGPSFSTQGNRISWEKWTMRVGFNYREGLTLHDIRYD
FT                   GRSLFYRLSLAEMFVPYGDPRAPYPRKAAFDLGSDGAGVNANNLRLGCDCLGLIKYFDA
FT                   WHNTSSGEPLKLPNVVCCHEQDDGILWKHTNFRTQNAVVARARILVLQTIITVSNYEYI
FT                   FAFQFSQDASIHYEVRATGILSTCPINIGDKVPYGTIVAPGVLAPYHQHLFCLRMDPWV
FT                   DGNVQNTLQVEESHAMPISDTNPFGVGYTTSSNNITEETGLDLDISKNRTFKIINEHSI
FT                   NPITGTPVGFKLLPSYSQMLLAHPDSYHAHRSEYAAHAVWVTRYDDEEMFPAGRHTMQS
FT                   TGGEGIHSAITRRKNDGSKTSVRNEDIVLWHTFGSTHNPRIEDWPVMPMDRMVVGIKPV
FT                   NFFTGNPGLDVPPSTQERNRSVLVNGDSDSLKSSSDTCCRL"
     MHPFDPLSPA EISEVTAIVR THFPGQLPVF RFITLKEPAK LEMLPFLENE HRGLPNITRP        60
     ARTSRVQVVM RSDKGENQLI ELLVDLDNKR VIKNEHLVGR HSYIDADYMR LVESACLADP       120
     KVQDEIKKLK LPANSTVIVE PWAYGTDGIN DMSERISMCW FYLRLLDNPD ANYYAYPLDL       180
     CAEVSEELKV TKIYYLPSSQ EERISDQARP FDINRIHSTV DSEYHPSLRP PPRNTTKPYQ       240
     VVQPEGPSFS TQGNRISWEK WTMRVGFNYR EGLTLHDIRY DGRSLFYRLS LAEMFVPYGD       300
     PRAPYPRKAA FDLGSDGAGV NANNLRLGCD CLGLIKYFDA WHNTSSGEPL KLPNVVCCHE       360
     QDDGILWKHT NFRTQNAVVA RARILVLQTI ITVSNYEYIF AFQFSQDASI HYEVRATGIL       420
     STCPINIGDK VPYGTIVAPG VLAPYHQHLF CLRMDPWVDG NVQNTLQVEE SHAMPISDTN       480
     PFGVGYTTSS NNITEETGLD LDISKNRTFK IINEHSINPI TGTPVGFKLL PSYSQMLLAH       540
     PDSYHAHRSE YAAHAVWVTR YDDEEMFPAG RHTMQSTGGE GIHSAITRRK NDGSKTSVRN       600
     EDIVLWHTFG STHNPRIEDW PVMPMDRMVV GIKPVNFFTG NPGLDVPPST QERNRSVLVN       660
     GDSDSLKSSS DTCCRL                                                       676
//

If you have problems or comments...

PBIL Back to PBIL home page