(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE336

PENCW_10.PE336       Location/Qualifiers
FT   CDS             join(complement(782581..782683),complement(782413..782513),
FT                   complement(782208..782335),complement(781313..782156))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212100" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950862"
FT                   /orf_name="Pc13g03360"
FT                   /product="Pc13g03360 protein"
FT                   /protein_id="CAP91405.1"
FT                   /db_xref="InterPro:IPR006745"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="UniParc:UPI0001830448"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y3"
FT                   /transl_table=1
FT                   /translation="MASNIPAGLRSADIGRFAIRATQIEKAKPVVAYWCNFHIVNQIIE
FT                   RGLHNTDDEIKLYTTNLVDKLEQFKLENPDNDTVTDTVAASAYVEQFGLEVFSRAEAAM
FT                   DANKVTKQTADTFQAAATFLELCSIWGPLDPEIAGRIKFAKFHAVRIVKAFKAGEDPNA
FT                   TNPAPKQEEEPVDDPDVQAFDESVAEQASKPRQASIEEVPDESDRFARELARKSTVDES
FT                   LHPSRTSSTPRPPPEIPSVPRNAPGAPPQSMDVDESNTGGLNLPSTPAAIGASSSVPKL
FT                   PDTPTAFQSFPPPSEGPSVSTPDPASFYDTPGASAPIPPPTAPAFVPTPAANVPVAPSP
FT                   YVPPQPSHGLDDNTVQMAQKHARWAVSALTFDDVDTAIKELRSSLKCLGAS"
     MASNIPAGLR SADIGRFAIR ATQIEKAKPV VAYWCNFHIV NQIIERGLHN TDDEIKLYTT        60
     NLVDKLEQFK LENPDNDTVT DTVAASAYVE QFGLEVFSRA EAAMDANKVT KQTADTFQAA       120
     ATFLELCSIW GPLDPEIAGR IKFAKFHAVR IVKAFKAGED PNATNPAPKQ EEEPVDDPDV       180
     QAFDESVAEQ ASKPRQASIE EVPDESDRFA RELARKSTVD ESLHPSRTSS TPRPPPEIPS       240
     VPRNAPGAPP QSMDVDESNT GGLNLPSTPA AIGASSSVPK LPDTPTAFQS FPPPSEGPSV       300
     STPDPASFYD TPGASAPIPP PTAPAFVPTP AANVPVAPSP YVPPQPSHGL DDNTVQMAQK       360
     HARWAVSALT FDDVDTAIKE LRSSLKCLGA S                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page