(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE337

PENCW_10.PE337       Location/Qualifiers
FT   CDS             join(complement(785542..785586),complement(785118..785488),
FT                   complement(784837..785068),complement(782880..784784))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212111" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825155"
FT                   /orf_name="Pc13g03370"
FT                   /product="Pc13g03370 protein"
FT                   /function="calcium-dependent cysteine-type endopeptidase
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91406.1"
FT                   /db_xref="GO:0004198"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="UniParc:UPI0001830449"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y4"
FT                   /transl_table=1
FT                   /translation="MSRPASTQSLISQARSAEEAIAAATSKKAALEAAINAAEHYMKAL
FT                   RLAPADDKKLLDAKCKELISKAEKIKAATDWQSAARAGPQKAFPSLRPPASTRKLTTRE
FT                   EIIILEGAKLNGYIFPPWSRAPPQDEFVYKGQLFTDTPDLHLSECQREIFAGWKRPHDL
FT                   LQTMNTAKQPYDIINPAMSASGETDLVQDVLTDCSVVASLCATTARSERGLGQHASPTL
FT                   YPCSEDKNPILSHSGKYIFRFYFNGSFRKVVIDDRLPSSKTTRSLHVIDRNNSNFLWPA
FT                   LVEKAYLKVRGGYDFPGSNSGTDLWVLTGWIPEQVFLHHDDSTSDEIWGRLYSAFWHGD
FT                   VVLTIGTGKLTELEQQGLGLVSEHDYAILDLKEVQGRRQFLLKNPWAGAEPHIQSSLTA
FT                   DLGSLGLNDKPPLSPGTFWMDCEQVLQNFENLYLNWNPGLFKYREDIHFTWDLSHGRVI
FT                   AGCFVKNPQFSISSDSGGTVWLLLGKHFKTDHQEFDTGESENETGFISIYIFQADGRRV
FT                   SLSDGALHRGPYVDSPNTLMRLEMPPKSTYTAVVSEQSLPSSAQNFTLSAFSTAPVAVA
FT                   PSLDKYLCLTKASGSWTAMTAGGNAESPRYHSNPQFSIRISEPTDVSILLETTEAELAT
FT                   HVKIFWSNGQRVSRVRSRDIIADSGDYRRGCALAETKSLDKGTYTIVCSTFAPDQFGRF
FT                   TLWISSTIPCVVQPLVSESAGRRAVLSEVGVLSPGKDRMLASLRVSRLTRIRLIARNKR
FT                   STVGLRAVAPSPVLMTVELGQGPYKEILATSEDGAHSDAASGVRVEDFDLLPSAESRRV
FT                   WIVIERIGGPGGQVEDHFEVEALAEERVEIGKWVIEDE"
     MSRPASTQSL ISQARSAEEA IAAATSKKAA LEAAINAAEH YMKALRLAPA DDKKLLDAKC        60
     KELISKAEKI KAATDWQSAA RAGPQKAFPS LRPPASTRKL TTREEIIILE GAKLNGYIFP       120
     PWSRAPPQDE FVYKGQLFTD TPDLHLSECQ REIFAGWKRP HDLLQTMNTA KQPYDIINPA       180
     MSASGETDLV QDVLTDCSVV ASLCATTARS ERGLGQHASP TLYPCSEDKN PILSHSGKYI       240
     FRFYFNGSFR KVVIDDRLPS SKTTRSLHVI DRNNSNFLWP ALVEKAYLKV RGGYDFPGSN       300
     SGTDLWVLTG WIPEQVFLHH DDSTSDEIWG RLYSAFWHGD VVLTIGTGKL TELEQQGLGL       360
     VSEHDYAILD LKEVQGRRQF LLKNPWAGAE PHIQSSLTAD LGSLGLNDKP PLSPGTFWMD       420
     CEQVLQNFEN LYLNWNPGLF KYREDIHFTW DLSHGRVIAG CFVKNPQFSI SSDSGGTVWL       480
     LLGKHFKTDH QEFDTGESEN ETGFISIYIF QADGRRVSLS DGALHRGPYV DSPNTLMRLE       540
     MPPKSTYTAV VSEQSLPSSA QNFTLSAFST APVAVAPSLD KYLCLTKASG SWTAMTAGGN       600
     AESPRYHSNP QFSIRISEPT DVSILLETTE AELATHVKIF WSNGQRVSRV RSRDIIADSG       660
     DYRRGCALAE TKSLDKGTYT IVCSTFAPDQ FGRFTLWISS TIPCVVQPLV SESAGRRAVL       720
     SEVGVLSPGK DRMLASLRVS RLTRIRLIAR NKRSTVGLRA VAPSPVLMTV ELGQGPYKEI       780
     LATSEDGAHS DAASGVRVED FDLLPSAESR RVWIVIERIG GPGGQVEDHF EVEALAEERV       840
     EIGKWVIEDE                                                              850
//

If you have problems or comments...

PBIL Back to PBIL home page