(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE338

PENCW_10.PE338       Location/Qualifiers
FT   CDS             join(786153..786253,786317..786861,786915..787152,
FT                   787203..787326)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129521"
FT                   /orf_name="Pc13g03380"
FT                   /product="Pc13g03380 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP91407.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000183044A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y5"
FT                   /transl_table=1
FT                   /translation="MAGQSKPALSPWGSAVAGATGAVLANAMVYPLDLVKTKLQVQVKE
FT                   KNGTVRPDNLEHYESTMDAITKIVEKEGYNGLYSGMAGALLGVASTNFAYFYWYSVVRT
FT                   LYMASAKPTQAPGTAIELSLGAVSGAVAQLFTIPVAVITTRQQTQPKGEKKGLIETGRE
FT                   VVDSEDGWSGLWRGLKASLILVVNPAITYGAYQRLKDVIFPGKNNLKPWEAFLLGAMSK
FT                   ALATIATQPLIVAKVGLQSRPPPSRNGKPFKTFGEVMKHIVDNEGLFSLFKGIGPQILK
FT                   GLLVQGLLMMTKERMELLFIVLFAYLKNIKKDKLRKAVDAAAEKAKTSMPATLK"
     MAGQSKPALS PWGSAVAGAT GAVLANAMVY PLDLVKTKLQ VQVKEKNGTV RPDNLEHYES        60
     TMDAITKIVE KEGYNGLYSG MAGALLGVAS TNFAYFYWYS VVRTLYMASA KPTQAPGTAI       120
     ELSLGAVSGA VAQLFTIPVA VITTRQQTQP KGEKKGLIET GREVVDSEDG WSGLWRGLKA       180
     SLILVVNPAI TYGAYQRLKD VIFPGKNNLK PWEAFLLGAM SKALATIATQ PLIVAKVGLQ       240
     SRPPPSRNGK PFKTFGEVMK HIVDNEGLFS LFKGIGPQIL KGLLVQGLLM MTKERMELLF       300
     IVLFAYLKNI KKDKLRKAVD AAAEKAKTSM PATLK                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page