(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE342

PENCW_10.PE342       Location/Qualifiers
FT   CDS             join(794204..794350,794405..794412,794448..795810)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950864"
FT                   /orf_name="Pc13g03420"
FT                   /product="Pc13g03420 protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP91411.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000183044D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z3"
FT                   /transl_table=1
FT                   /translation="MLHSASLLLVSLLAALPVNADGLYTKNSPVIQLNPKTYNSLIANS
FT                   NYTSIVDSLPPQPSLTHPLRFYAPWCGHCKNLKPAYEKAAKNLDGLAKVAAINCDDDEN
FT                   KPFCGQMGVQGFPTLKIVTPSKKPGKPRVEDYQGARSAKGIVDAVVDRIPNHVKRATDK
FT                   DLDKWLGQNEDRPKAILFTEKGTTGALIRALAVDFLGAIDIAQVRNKESASVKKFDVTE
FT                   FPTLVLIPSADAEPKIYAGDLKKKPITEFLSQAAAPNPDASPRSASNSKPKQKSKPASK
FT                   PTSVVDDAEDLKPTASQDQDETDPSEKPVQVPIPAPPIPTLATPESVESACLTPKSGTC
FT                   VLVILPETSEPDAALPAHATEALASVAEIGHKHALRGTHLFPLYAVPAINTASKTLREA
FT                   LELADGQTVEIIALNARRGWWRRFSGADADFGAVAVESWVDAIRLGDGTKEKLPEGIVV
FT                   SVEAETESEAEVKPEAEAEVEPEAETVEAEAETKAETEEQAAEHDEL"
     MLHSASLLLV SLLAALPVNA DGLYTKNSPV IQLNPKTYNS LIANSNYTSI VDSLPPQPSL        60
     THPLRFYAPW CGHCKNLKPA YEKAAKNLDG LAKVAAINCD DDENKPFCGQ MGVQGFPTLK       120
     IVTPSKKPGK PRVEDYQGAR SAKGIVDAVV DRIPNHVKRA TDKDLDKWLG QNEDRPKAIL       180
     FTEKGTTGAL IRALAVDFLG AIDIAQVRNK ESASVKKFDV TEFPTLVLIP SADAEPKIYA       240
     GDLKKKPITE FLSQAAAPNP DASPRSASNS KPKQKSKPAS KPTSVVDDAE DLKPTASQDQ       300
     DETDPSEKPV QVPIPAPPIP TLATPESVES ACLTPKSGTC VLVILPETSE PDAALPAHAT       360
     EALASVAEIG HKHALRGTHL FPLYAVPAIN TASKTLREAL ELADGQTVEI IALNARRGWW       420
     RRFSGADADF GAVAVESWVD AIRLGDGTKE KLPEGIVVSV EAETESEAEV KPEAEAEVEP       480
     EAETVEAEAE TKAETEEQAA EHDEL                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page