(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE343

PENCW_10.PE343       Location/Qualifiers
FT   CDS             join(complement(796333..799307),complement(796139..796271))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210833" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950865"
FT                   /orf_name="Pc13g03430"
FT                   /product="Pc13g03430 protein"
FT                   /protein_id="CAP91412.1"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="UniParc:UPI000183050F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z4"
FT                   /transl_table=1
FT                   /translation="MPRKAIDSRIPALIRNGVQEKKRSFFVVVGDHAKDVIVHLHYIMS
FT                   SVDVKQNKSVLWAYKKDLLGFTSHRKKREMKIKKEVKRGIREPNQEDPFELFITLNQIR
FT                   YVYYKETEKILGNTYGMCVLQDFEAMTPNLLARTVETVEGGGLVILLLKSMTSLKQLYT
FT                   MSMDIHSRYRTEAHDDVVARFNERFILSLGSCDSCLVVDDELNVLPISGGKSVKPLPAP
FT                   ETTDESASGTKKELKEIKESLADSKPVGPLLSLARTVDQAKALLTFVDAIAEKTLKSTV
FT                   TLTAGRGRGKSAALGVAIAAAVAHGYSNIFITSPSPENLKTLFEFIFKGFDALGYLDHV
FT                   DYTILQSTNPDFNKAVVRVNIHRNHRQTIQYIQPQDAQVLGQAELLVIDEAAAIPLPLV
FT                   RKLMGPYLVFMSSTINGYEGTGRSLSLKLIQQLREQSRTGVKTDDTDIADRSTGKSAKG
FT                   ADKNLSGRTLREITLSEPIRYAPGDSVEKWLNKVLCLDATLPKSHMNTQGCPHPSQCQL
FT                   LQVNRDTLFSFHPVSEKFLQQMMALYVASHYKNTPNDLQLMSDAPAHQLYVLVPPIDEG
FT                   ATKLPEPLCVIQVALEGRISRQSVLNSLSRGQRAGGDLIPWLVSQQFQDENFASLSGAR
FT                   IVRIATNPEYVGMGYGSRAMQLLVDFFEGKFTNLEEENIAAEEQMVRVTDEELASSSLL
FT                   DDNVHVRDIRSMPPLFGKLTERRPDVLDYVGVSYGLTPSLHKFWKRGSFVPVYLRQTPN
FT                   ELTGEHSCVMVRTLSTGEADDAWLSAYARDFHKRFLSLMSYQFGQFPSVLSLSICEAAN
FT                   SGAKKDPTFKPRTLQKADLDAAFSPFDLKRLDSYANNLLDYHVILDLVPALSDYYFANR
FT                   LDGKVSLSGVQQSILLAIGLQHKSLDDLEKELNLPSSQLLAMFLKIVRKVSTHFRNLIE
FT                   NEIEQSLPAQKVRVETSAAHDDEPEVNLQPLPISLEDELREGSKKIDEEMLAKQRALSA
FT                   ANPDGPDGSKSSKRKKIETARDIYDKEIDSKRQKMIKKGTEGRKKR"
     MPRKAIDSRI PALIRNGVQE KKRSFFVVVG DHAKDVIVHL HYIMSSVDVK QNKSVLWAYK        60
     KDLLGFTSHR KKREMKIKKE VKRGIREPNQ EDPFELFITL NQIRYVYYKE TEKILGNTYG       120
     MCVLQDFEAM TPNLLARTVE TVEGGGLVIL LLKSMTSLKQ LYTMSMDIHS RYRTEAHDDV       180
     VARFNERFIL SLGSCDSCLV VDDELNVLPI SGGKSVKPLP APETTDESAS GTKKELKEIK       240
     ESLADSKPVG PLLSLARTVD QAKALLTFVD AIAEKTLKST VTLTAGRGRG KSAALGVAIA       300
     AAVAHGYSNI FITSPSPENL KTLFEFIFKG FDALGYLDHV DYTILQSTNP DFNKAVVRVN       360
     IHRNHRQTIQ YIQPQDAQVL GQAELLVIDE AAAIPLPLVR KLMGPYLVFM SSTINGYEGT       420
     GRSLSLKLIQ QLREQSRTGV KTDDTDIADR STGKSAKGAD KNLSGRTLRE ITLSEPIRYA       480
     PGDSVEKWLN KVLCLDATLP KSHMNTQGCP HPSQCQLLQV NRDTLFSFHP VSEKFLQQMM       540
     ALYVASHYKN TPNDLQLMSD APAHQLYVLV PPIDEGATKL PEPLCVIQVA LEGRISRQSV       600
     LNSLSRGQRA GGDLIPWLVS QQFQDENFAS LSGARIVRIA TNPEYVGMGY GSRAMQLLVD       660
     FFEGKFTNLE EENIAAEEQM VRVTDEELAS SSLLDDNVHV RDIRSMPPLF GKLTERRPDV       720
     LDYVGVSYGL TPSLHKFWKR GSFVPVYLRQ TPNELTGEHS CVMVRTLSTG EADDAWLSAY       780
     ARDFHKRFLS LMSYQFGQFP SVLSLSICEA ANSGAKKDPT FKPRTLQKAD LDAAFSPFDL       840
     KRLDSYANNL LDYHVILDLV PALSDYYFAN RLDGKVSLSG VQQSILLAIG LQHKSLDDLE       900
     KELNLPSSQL LAMFLKIVRK VSTHFRNLIE NEIEQSLPAQ KVRVETSAAH DDEPEVNLQP       960
     LPISLEDELR EGSKKIDEEM LAKQRALSAA NPDGPDGSKS SKRKKIETAR DIYDKEIDSK      1020
     RQKMIKKGTE GRKKR                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page