(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE344

PENCW_10.PE344       Location/Qualifiers
FT   CDS             join(800677..800720,800787..800845,800908..801227,
FT                   801292..801705,801760..801912,801967..802391,8
FT                   02443..804015)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210834" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950866"
FT                   /orf_name="Pc13g03440"
FT                   /product="Pc13g03440 protein"
FT                   /protein_id="CAP91413.1"
FT                   /db_xref="UniParc:UPI0001830510"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z5"
FT                   /transl_table=1
FT                   /translation="MIQLSSDLGLKLCVGIFLLSSLFLTTSYNTTYAFDRPISTSVLVC
FT                   FLTGLTLLVWSRFVSVGSSPSSPTSKRPAIPLAEQFELPSRASTSSFALGDVETRPRAR
FT                   FQPWWIKLALLLGLCGLRIESFRQVTRNTECAPAGYAYAIPFVISLYDYWRNHRSRQVD
FT                   RYVPTQRFEKLPLQVVYSVSRRSFYYLTQSRFRGLIAAAFLSIGGLFASSFSAGTRSTY
FT                   VCPIVLHSASRLRSYRLFNLFADSIILIGITELCQIGAQFDDARRKRALTFLGTGLLGL
FT                   SLVWSVISFWVPDSSPELAGQPMLDLEYSRGAFSQSVLVVILVLSAWHMLPHFDILGVS
FT                   IIGGFVIVYFSSLSALTEPSPFPFISLTHAVLPLAASLTGTLLFLLARVVHDEEPKLYR
FT                   TNVAIQILFAVLFGISLVFAVSKHRLEDMHPIEFLISNGQIQHHNYVAQAAKSKTLGDA
FT                   VTEYRRRYNQHPPPGFDEWYRYATSRSSAIIDDFDQIYHDLLPFRALAPEHIRAMTHEL
FT                   ATNPFNDLGGIRIRNGTAMVQEGIKPTHAWMVAGAADMMKDFAKYLPDMDLVFNLNDEP
FT                   RVAVPWEKISMLNRQTGMQEMISENRVVQTWSTNREEGWAPIEPADQTNITVFTDGAWR
FT                   GVFDPYVSAVCPPSSKARSQRIWNRHDICLSCVAPHSMGQFPLDFNLASEICHQPDLAF
FT                   LHGLLISPASFKVSQELIPVFSQSALTGFNDILFPSPWNYIEKVKYQPTKEHPDPEYGH
FT                   KKNSLYWLGSTSEGVSRFGEWKGMPRQRFAHLINNNTNNQVSILLPADPKENSFRYEIM
FT                   DGSAPTSDLHLQTAVHLADPIVRCGDCDEQAAELSTAGWADFQAHWWHRFLFDLDGAGF
FT                   SGRFLPFLHSHSLPLKTGLFRQWFDSRVTSWLHFVPVDIRLHGLWSTLAYFAGVSAPAS
FT                   EENGPNAPKMRMKAHDRQGKWIAEEGRKWANTALRKEDMEIYFFRLLLEWGRLTDDQRD
FT                   VLGFGH"
     MIQLSSDLGL KLCVGIFLLS SLFLTTSYNT TYAFDRPIST SVLVCFLTGL TLLVWSRFVS        60
     VGSSPSSPTS KRPAIPLAEQ FELPSRASTS SFALGDVETR PRARFQPWWI KLALLLGLCG       120
     LRIESFRQVT RNTECAPAGY AYAIPFVISL YDYWRNHRSR QVDRYVPTQR FEKLPLQVVY       180
     SVSRRSFYYL TQSRFRGLIA AAFLSIGGLF ASSFSAGTRS TYVCPIVLHS ASRLRSYRLF       240
     NLFADSIILI GITELCQIGA QFDDARRKRA LTFLGTGLLG LSLVWSVISF WVPDSSPELA       300
     GQPMLDLEYS RGAFSQSVLV VILVLSAWHM LPHFDILGVS IIGGFVIVYF SSLSALTEPS       360
     PFPFISLTHA VLPLAASLTG TLLFLLARVV HDEEPKLYRT NVAIQILFAV LFGISLVFAV       420
     SKHRLEDMHP IEFLISNGQI QHHNYVAQAA KSKTLGDAVT EYRRRYNQHP PPGFDEWYRY       480
     ATSRSSAIID DFDQIYHDLL PFRALAPEHI RAMTHELATN PFNDLGGIRI RNGTAMVQEG       540
     IKPTHAWMVA GAADMMKDFA KYLPDMDLVF NLNDEPRVAV PWEKISMLNR QTGMQEMISE       600
     NRVVQTWSTN REEGWAPIEP ADQTNITVFT DGAWRGVFDP YVSAVCPPSS KARSQRIWNR       660
     HDICLSCVAP HSMGQFPLDF NLASEICHQP DLAFLHGLLI SPASFKVSQE LIPVFSQSAL       720
     TGFNDILFPS PWNYIEKVKY QPTKEHPDPE YGHKKNSLYW LGSTSEGVSR FGEWKGMPRQ       780
     RFAHLINNNT NNQVSILLPA DPKENSFRYE IMDGSAPTSD LHLQTAVHLA DPIVRCGDCD       840
     EQAAELSTAG WADFQAHWWH RFLFDLDGAG FSGRFLPFLH SHSLPLKTGL FRQWFDSRVT       900
     SWLHFVPVDI RLHGLWSTLA YFAGVSAPAS EENGPNAPKM RMKAHDRQGK WIAEEGRKWA       960
     NTALRKEDME IYFFRLLLEW GRLTDDQRDV LGFGH                                  995
//

If you have problems or comments...

PBIL Back to PBIL home page