(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE345

PENCW_10.PE345       Location/Qualifiers
FT   CDS             join(complement(805672..805797),complement(805387..805619),
FT                   complement(804565..805309))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950867"
FT                   /orf_name="Pc13g03450"
FT                   /product="Pc13g03450 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP91414.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI0001830511"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z6"
FT                   /transl_table=1
FT                   /translation="MHVFSTILPALALLAQVSSAAYTLRDDYGASDSFFDKFNFFTDTD
FT                   PTNGFVSYVDRSTASRNGLINTGNGVYIGVDHANIATRPGRQSVRLESTATYKHGLVIL
FT                   DLAHMPSSTCGTWPAFWMLGPNWPNNGEIDIIEGVNEQTQNQVALHTSNGCTINNSGFT
FT                   GNLETPNCYVQAPGQSANSGCVIQDGSTQSYGTGFNNVGGGVYATEWTGSAISVWFFPS
FT                   YAVPADISSGNPNPAGWGTPSARFAGGCNIDSKFNDLQIVFDITFCGDWAGSVWGSSSC
FT                   ASRAWSCVDYVQNNPTAFQESYWRVRSLKVYQDAASSKGGAEGEDVGAGDEVGVNWDPS
FT                   TWYGLSARASMKHRREHYRHKRGHGHA"
     MHVFSTILPA LALLAQVSSA AYTLRDDYGA SDSFFDKFNF FTDTDPTNGF VSYVDRSTAS        60
     RNGLINTGNG VYIGVDHANI ATRPGRQSVR LESTATYKHG LVILDLAHMP SSTCGTWPAF       120
     WMLGPNWPNN GEIDIIEGVN EQTQNQVALH TSNGCTINNS GFTGNLETPN CYVQAPGQSA       180
     NSGCVIQDGS TQSYGTGFNN VGGGVYATEW TGSAISVWFF PSYAVPADIS SGNPNPAGWG       240
     TPSARFAGGC NIDSKFNDLQ IVFDITFCGD WAGSVWGSSS CASRAWSCVD YVQNNPTAFQ       300
     ESYWRVRSLK VYQDAASSKG GAEGEDVGAG DEVGVNWDPS TWYGLSARAS MKHRREHYRH       360
     KRGHGHA                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page