(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE348

PENCW_10.PE348       Location/Qualifiers
FT   CDS             join(816456..817017,817074..817435)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190226" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950869"
FT                   /orf_name="Pc13g03480"
FT                   /product="Pc13g03480 protein"
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP91417.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI0001830514"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z9"
FT                   /transl_table=1
FT                   /translation="MLAVSGTDTLVQRASQSSAYMSSPSMSTRAATCNGHSEYCTRSYS
FT                   NITFIGSHDSAFVGPLPQQNQNIDIEAQLDMGIRYLQVQTHRSVIDENVIELCHTSCLL
FT                   EDAGPLKEYLETIKNWLDANPNEVVTLLLTNGDSVPITEFGDTFSSSGISNYAYVPSEN
FT                   PLSITDWPTLGDMISSGKRLVVFLDYGADTTKVNFIQDEFAYYFETAYGVTDASFPNCS
FT                   IDRPSGAAATGRMGIVNHFLDVDVLGIKIPARHEADNTNAATGPGSIGAQAALCAGLYG
FT                   YAPNVVLADFVDKGDVITAQKNLNGL"
     MLAVSGTDTL VQRASQSSAY MSSPSMSTRA ATCNGHSEYC TRSYSNITFI GSHDSAFVGP        60
     LPQQNQNIDI EAQLDMGIRY LQVQTHRSVI DENVIELCHT SCLLEDAGPL KEYLETIKNW       120
     LDANPNEVVT LLLTNGDSVP ITEFGDTFSS SGISNYAYVP SENPLSITDW PTLGDMISSG       180
     KRLVVFLDYG ADTTKVNFIQ DEFAYYFETA YGVTDASFPN CSIDRPSGAA ATGRMGIVNH       240
     FLDVDVLGIK IPARHEADNT NAATGPGSIG AQAALCAGLY GYAPNVVLAD FVDKGDVITA       300
     QKNLNGL                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page