(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE349

PENCW_10.PE349       Location/Qualifiers
FT   CDS             complement(817740..819095)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950870"
FT                   /orf_name="Pc13g03490"
FT                   /product="Pc13g03490 protein"
FT                   /protein_id="CAP91418.1"
FT                   /db_xref="UniParc:UPI0001830515"
FT                   /db_xref="UniProtKB/TrEMBL:B6H200"
FT                   /transl_table=1
FT                   /translation="MKVLKSVALASLLSFTGFGQHAFASSSLKKPILHDFDDDGVDGGL
FT                   YRPSVAGPKSRIAVYIMHAEQDYTSFVACEALQERGFTVFCANNDASKSGYMSDLNFED
FT                   MMTNVNQGMTYLRNLTDIDKVVILGHSGGGAMMAAYQDIAENGASACQGSEKIYPCSDE
FT                   MDDLEPADGLILLDANYGLSTMAFLSLSPAIIDESSPSKINETLNVFNPANGFNNTRSN
FT                   YTAEFKKAFQSGAVARNNRIIKHAQERLAAIEAGNGTYSDDEPFTVPASLYIGFNNLFF
FT                   AQDTRYLAHTTHAWPLLHKNGTTTQVVRSVRVPANFKSFADQWEGGALKTTVKRYLSTF
FT                   AIRVGDDYNLRADGIDGIDYASSNLAPVASIRGVSVPLLTMGMTGHYEYLNAEKLHLAA
FT                   GSNDTTIAFVEGAQHTIDTCTACESFPGEFGNTVVTCFNHVENWLAKKGRFI"
     MKVLKSVALA SLLSFTGFGQ HAFASSSLKK PILHDFDDDG VDGGLYRPSV AGPKSRIAVY        60
     IMHAEQDYTS FVACEALQER GFTVFCANND ASKSGYMSDL NFEDMMTNVN QGMTYLRNLT       120
     DIDKVVILGH SGGGAMMAAY QDIAENGASA CQGSEKIYPC SDEMDDLEPA DGLILLDANY       180
     GLSTMAFLSL SPAIIDESSP SKINETLNVF NPANGFNNTR SNYTAEFKKA FQSGAVARNN       240
     RIIKHAQERL AAIEAGNGTY SDDEPFTVPA SLYIGFNNLF FAQDTRYLAH TTHAWPLLHK       300
     NGTTTQVVRS VRVPANFKSF ADQWEGGALK TTVKRYLSTF AIRVGDDYNL RADGIDGIDY       360
     ASSNLAPVAS IRGVSVPLLT MGMTGHYEYL NAEKLHLAAG SNDTTIAFVE GAQHTIDTCT       420
     ACESFPGEFG NTVVTCFNHV ENWLAKKGRF I                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page