(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE35

PENCW_10.PE35        Location/Qualifiers
FT   CDS             join(82534..82708,82894..83639)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977821"
FT                   /orf_name="Pc13g00350"
FT                   /product="Putative uncharacterized protein Pc13g00350 "
FT                   /protein_id="CAP91104.1"
FT                   /db_xref="UniParc:UPI0001830DC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H180"
FT                   /transl_table=1
FT                   /translation="MMKPQDNYCQLLMPQNYLYTIKHGIPQGGLAVIATFIFWSTARRV
FT                   ANAHRTSQYYRAKILLKTFPWKPVTPYRAPKQNPMDSVTPRKKDNEDHSVFLSSVAPIE
FT                   LSLTTSLQLPKEASNVGIPELDARGLSKQNNLETTFPQWQTKRAVHSKRENESTLHRTS
FT                   EKRTENSCRRNRVRKSSLGQHGSKASQCISSASFKNRTLSKAMKLGPITYRGALKMTGK
FT                   LCKAQLPLLKNHFRDRSDLFSDGEALLHEIATVHPKYNQIIQTLPILLNFIPGELKEKL
FT                   MIEENAEWLKMGAYLVNKWISRSQA"
     MMKPQDNYCQ LLMPQNYLYT IKHGIPQGGL AVIATFIFWS TARRVANAHR TSQYYRAKIL        60
     LKTFPWKPVT PYRAPKQNPM DSVTPRKKDN EDHSVFLSSV APIELSLTTS LQLPKEASNV       120
     GIPELDARGL SKQNNLETTF PQWQTKRAVH SKRENESTLH RTSEKRTENS CRRNRVRKSS       180
     LGQHGSKASQ CISSASFKNR TLSKAMKLGP ITYRGALKMT GKLCKAQLPL LKNHFRDRSD       240
     LFSDGEALLH EIATVHPKYN QIIQTLPILL NFIPGELKEK LMIEENAEWL KMGAYLVNKW       300
     ISRSQA                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page