(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE350

PENCW_10.PE350       Location/Qualifiers
FT   CDS             join(complement(821218..821412),complement(820806..821151),
FT                   complement(820605..820725),complement(820323..820524))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950871"
FT                   /orf_name="Pc13g03500"
FT                   /product="Pc13g03500 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91419.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI0001830516"
FT                   /db_xref="UniProtKB/TrEMBL:B6H201"
FT                   /transl_table=1
FT                   /translation="MSLNWTNLIRFISEEDGQIHLGEVDTRKYPDIGLTVLNGERVAVN
FT                   LVKGSIFDGVVTETIMHVGRLLAPIGIEEVPIIRCMGLNYRDHATEANMPIPDVPVLFI
FT                   KPRTALNGPYPAKINVPKIAQDGSSDYEAELSIVLSKSGRDIPESEAMDYVLGYTCSND
FT                   VSARTQQFKNSQWCFSKGLDGSCPIGPVLVSPSVVGNPHNLRIKAIHNGTVVQDSNTRE
FT                   MIFDIAKTIAFLSQGTTLERGTIIMTGTGPGIGVMRNPKVVLNDGDDMRVEIENIGTLI
FT                   NKVHYE"
     MSLNWTNLIR FISEEDGQIH LGEVDTRKYP DIGLTVLNGE RVAVNLVKGS IFDGVVTETI        60
     MHVGRLLAPI GIEEVPIIRC MGLNYRDHAT EANMPIPDVP VLFIKPRTAL NGPYPAKINV       120
     PKIAQDGSSD YEAELSIVLS KSGRDIPESE AMDYVLGYTC SNDVSARTQQ FKNSQWCFSK       180
     GLDGSCPIGP VLVSPSVVGN PHNLRIKAIH NGTVVQDSNT REMIFDIAKT IAFLSQGTTL       240
     ERGTIIMTGT GPGIGVMRNP KVVLNDGDDM RVEIENIGTL INKVHYE                     287
//

If you have problems or comments...

PBIL Back to PBIL home page