(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE351

PENCW_10.PE351       Location/Qualifiers
FT   CDS             join(complement(822885..823305),complement(822604..822711),
FT                   complement(822298..822532),complement(822129..822238),
FT                   complement(822041..822072))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825156"
FT                   /orf_name="Pc13g03510"
FT                   /product="Pc13g03510 protein"
FT                   /protein_id="CAP91420.1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="UniParc:UPI0001830517"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y7"
FT                   /transl_table=1
FT                   /translation="MTVNITPRINLVRIAHVFYTYKDLNKAHEFLLDFGFQEVKRAGKD
FT                   IYYRGTSSQPFVYCARHGEEDVFGGAAFVVESEADLVASQELPGATEIYGLSDAPGGGR
FT                   CVTFHDPIDDFPFHLVYGQTHWADEKALPQLNFNFVSPAPVHKIGHFGTCVTDFAKAFD
FT                   FYTTRFNFKPSDVYSTGKDITTFLHLDRGSELVDHHCFFFFEGPKPHVHHSSFETHDFD
FT                   TQVLGHDWLRSKGYQNCWGVGRHIMGSQIFDYWFDPSHFIIEHYVDGDLVNDEYPINRS
FT                   LASPGNLHVWGPDLPPTFLQ"
     MTVNITPRIN LVRIAHVFYT YKDLNKAHEF LLDFGFQEVK RAGKDIYYRG TSSQPFVYCA        60
     RHGEEDVFGG AAFVVESEAD LVASQELPGA TEIYGLSDAP GGGRCVTFHD PIDDFPFHLV       120
     YGQTHWADEK ALPQLNFNFV SPAPVHKIGH FGTCVTDFAK AFDFYTTRFN FKPSDVYSTG       180
     KDITTFLHLD RGSELVDHHC FFFFEGPKPH VHHSSFETHD FDTQVLGHDW LRSKGYQNCW       240
     GVGRHIMGSQ IFDYWFDPSH FIIEHYVDGD LVNDEYPINR SLASPGNLHV WGPDLPPTFL       300
     Q                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page