(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE352

PENCW_10.PE352       Location/Qualifiers
FT   CDS             join(complement(826118..826181),complement(825568..825955),
FT                   complement(825134..825499),complement(823622..825086))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076579" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978322"
FT                   /orf_name="Pc13g03520"
FT                   /product="Pc13g03520 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91421.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830518"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y8"
FT                   /transl_table=1
FT                   /translation="MVCQGFDKGISICSKAHEVTSGSLQKRRKCRRSEDTAQSRHLHLQ
FT                   SNSYNPNLCSDNNDLDVLNDESETEGLVPTDYAETVHRTKTDEGGKTQTSHLNMHDLSY
FT                   ILHPSHESTIPNPDRNRSACSNDGEKGGVRRQACAELGVSQSAMNQMIRAFFENMVAIN
FT                   IFHEPSFAEKLSNISSLCQLSALLAAIAAYSSRFIGSGTNISSLGEHRTAGKSQQQPEY
FT                   FVGLAFNYVNKALVACDDETPSLCILQALIIATHCQLTRGVRGKAWRSLGLGVAKPDNI
FT                   HQWQADEEKRRAFWAVWEMDVFASTIRQAPTAIDWGHMEILLPVDNANWFLGRPSSSCF
FT                   MDADPNQSWKALQDSGNQSPKAWFLVINSFMKIAHSISDPRRLSAMDNAGHYQPGHPTP
FT                   GLDEERCWKLEKLGNAVRCFNMALPSHLRYHDQYLAFGAPVQGRLESQRQQHCSLYNIF
FT                   VMTQLVWLMIHRHDAFRPQTRQAETNHFYPPGDGVVAGGVISSSHETECTAQRQYYDAA
FT                   DRILRIVSQSCEDHIQHISPFLSSTFWLVSAVQLVRKHFTREPANRSLIESRFDVVYMT
FT                   YRRCVEFWGTQTAMQRNLESLEEQLEARKRKMNSHESQASSAHQTSHIERHTKRKRTHQ
FT                   TVSRTTEQDYLPHLPTGRSVRNNLPEYIPETPIPLEASALPVGDSQSYVRQHPAAVDSM
FT                   AMVDMMLPPQSDRGHSSGTCMMPTSSDYFDPTVLNLGDVHDDQILDLRDFDLSGGIQDL
FT                   LAEWITY"
     MVCQGFDKGI SICSKAHEVT SGSLQKRRKC RRSEDTAQSR HLHLQSNSYN PNLCSDNNDL        60
     DVLNDESETE GLVPTDYAET VHRTKTDEGG KTQTSHLNMH DLSYILHPSH ESTIPNPDRN       120
     RSACSNDGEK GGVRRQACAE LGVSQSAMNQ MIRAFFENMV AINIFHEPSF AEKLSNISSL       180
     CQLSALLAAI AAYSSRFIGS GTNISSLGEH RTAGKSQQQP EYFVGLAFNY VNKALVACDD       240
     ETPSLCILQA LIIATHCQLT RGVRGKAWRS LGLGVAKPDN IHQWQADEEK RRAFWAVWEM       300
     DVFASTIRQA PTAIDWGHME ILLPVDNANW FLGRPSSSCF MDADPNQSWK ALQDSGNQSP       360
     KAWFLVINSF MKIAHSISDP RRLSAMDNAG HYQPGHPTPG LDEERCWKLE KLGNAVRCFN       420
     MALPSHLRYH DQYLAFGAPV QGRLESQRQQ HCSLYNIFVM TQLVWLMIHR HDAFRPQTRQ       480
     AETNHFYPPG DGVVAGGVIS SSHETECTAQ RQYYDAADRI LRIVSQSCED HIQHISPFLS       540
     STFWLVSAVQ LVRKHFTREP ANRSLIESRF DVVYMTYRRC VEFWGTQTAM QRNLESLEEQ       600
     LEARKRKMNS HESQASSAHQ TSHIERHTKR KRTHQTVSRT TEQDYLPHLP TGRSVRNNLP       660
     EYIPETPIPL EASALPVGDS QSYVRQHPAA VDSMAMVDMM LPPQSDRGHS SGTCMMPTSS       720
     DYFDPTVLNL GDVHDDQILD LRDFDLSGGI QDLLAEWITY                             760
//

If you have problems or comments...

PBIL Back to PBIL home page