(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE353

PENCW_10.PE353       Location/Qualifiers
FT   CDS             join(complement(827736..827742),complement(827346..827574),
FT                   complement(827132..827267))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825157"
FT                   /orf_name="Pc13g03530"
FT                   /product="Putative uncharacterized protein Pc13g03530 "
FT                   /protein_id="CAP91422.1"
FT                   /db_xref="UniParc:UPI00018305DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y9"
FT                   /transl_table=1
FT                   /translation="MIAIDKFFKYVVFPDLKTVMNQLLDFILSDRRLQIDFDHATYKSI
FT                   VKALRGQNNFMDLAFEAILPEIKGFQGKLITTQDLHKDSPNTIVEFGISKEPEYVASSA
FT                   IRDSEISDQDDLMDLPRPR"
     MIAIDKFFKY VVFPDLKTVM NQLLDFILSD RRLQIDFDHA TYKSIVKALR GQNNFMDLAF        60
     EAILPEIKGF QGKLITTQDL HKDSPNTIVE FGISKEPEYV ASSAIRDSEI SDQDDLMDLP       120
     RPR                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page