(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE354

PENCW_10.PE354       Location/Qualifiers
FT   CDS             join(complement(830381..830504),complement(830239..830337),
FT                   complement(830046..830194),complement(829339..829952),
FT                   complement(828420..829278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244262" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950872"
FT                   /orf_name="Pc13g03540"
FT                   /product="Pc13g03540 protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91423.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI00018305DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z0"
FT                   /transl_table=1
FT                   /translation="MSSTAQATNSDKVEDHGLDTEFLIVGAGPAGAALACFLGSHARRA
FT                   QGHYDQQRGRDSKYPSRTHYQYGSTWYVTECLRDIGLYEELQKLGSTGEDHMQHTRWCH
FT                   SMAGEEYARIHSWGNDPRRKGDYELASPCEPFDLPQTVMEPVLVRHAALKGFKCRFDTT
FT                   LISFNEEKTGLITATIRDEISKNEYYIRTKYLLGADGARSQVVKQLNLPLAVLPRQGMA
FT                   INVLVRTDLSHLVKNRTGNLHWVMQPDREHPNFGWMGIVRMVKPWSEWMFILFPDRSYN
FT                   RSQGQPSTEEYQKRVQEFIGDDTPAEILDISTWYINEIVAEKYSEGNIFCLGDAVHRHP
FT                   PLNGLGSNTCIQDAFNLAWKLAYVHKGLASPSLLSTYSSERQPVGHSIITRANQAYRDH
FT                   FHVWEALGMLPTDLSERKQILEELRSATPQGSNRRRALHAAIKHTSHEFHGLGIKMNQH
FT                   YQGQGIYMADEPHPYDQVGRAGEDKVLYHGPSTYPGSRLPHVWLNKATPGEAISMIDIA
FT                   GHGVFTVFTGIGGGVWKEAAVAVAEKLSVPIRACSIGFRQDWEDVYFEWGSVRGVEESG
FT                   AVLVRPDRFVAWRASEALQDCEACEGKLLTVMRSILGF"
     MSSTAQATNS DKVEDHGLDT EFLIVGAGPA GAALACFLGS HARRAQGHYD QQRGRDSKYP        60
     SRTHYQYGST WYVTECLRDI GLYEELQKLG STGEDHMQHT RWCHSMAGEE YARIHSWGND       120
     PRRKGDYELA SPCEPFDLPQ TVMEPVLVRH AALKGFKCRF DTTLISFNEE KTGLITATIR       180
     DEISKNEYYI RTKYLLGADG ARSQVVKQLN LPLAVLPRQG MAINVLVRTD LSHLVKNRTG       240
     NLHWVMQPDR EHPNFGWMGI VRMVKPWSEW MFILFPDRSY NRSQGQPSTE EYQKRVQEFI       300
     GDDTPAEILD ISTWYINEIV AEKYSEGNIF CLGDAVHRHP PLNGLGSNTC IQDAFNLAWK       360
     LAYVHKGLAS PSLLSTYSSE RQPVGHSIIT RANQAYRDHF HVWEALGMLP TDLSERKQIL       420
     EELRSATPQG SNRRRALHAA IKHTSHEFHG LGIKMNQHYQ GQGIYMADEP HPYDQVGRAG       480
     EDKVLYHGPS TYPGSRLPHV WLNKATPGEA ISMIDIAGHG VFTVFTGIGG GVWKEAAVAV       540
     AEKLSVPIRA CSIGFRQDWE DVYFEWGSVR GVEESGAVLV RPDRFVAWRA SEALQDCEAC       600
     EGKLLTVMRS ILGF                                                         614
//

If you have problems or comments...

PBIL Back to PBIL home page