(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE355

PENCW_10.PE355       Location/Qualifiers
FT   CDS             complement(831174..832496)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950873"
FT                   /orf_name="Pc13g03550"
FT                   /product="Putative uncharacterized protein Pc13g03550 "
FT                   /protein_id="CAP91424.1"
FT                   /db_xref="UniParc:UPI00018305DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U6"
FT                   /transl_table=1
FT                   /translation="MPPKSSTRKGGKKGMSHTLSPDPSSSPIRKKQKGTPSAIRDRANS
FT                   SSRSGIPKLEPSSGAHPPSEYWNQLTDFQRDFLDGAMQETVSNLYDLGAEIKAETSSPA
FT                   PSSIINDENESQYSLGTPVPGPIPAPFPYTVDDLTLCHAPTADPTGYPIFVSRNGRWDW
FT                   YYLSSNTKTTETPANGTSNGNTTNTKSEFANDLCLSPNQFPCTKDDTTLCPCPNPGPNS
FT                   AYSPTFSSQNGRWEWIFLPSNTDTESSPPKVKMEDIPEANPRVQRPSNPLSTTFSATDL
FT                   DHFVFHGLQDSDDDENIIERARTENIELAKTVKHVKFFMNNSHDKHFVPFQVPALIGYE
FT                   NWEPWLAGMYLLFRQHSVWPVVTAELEPLPPGHNLHLWYNRMLDCAVALIYANVSDVVR
FT                   NTHCLMSTLHDDDPDELMAHLYAHYAEPDLTHPPHEESELD"
     MPPKSSTRKG GKKGMSHTLS PDPSSSPIRK KQKGTPSAIR DRANSSSRSG IPKLEPSSGA        60
     HPPSEYWNQL TDFQRDFLDG AMQETVSNLY DLGAEIKAET SSPAPSSIIN DENESQYSLG       120
     TPVPGPIPAP FPYTVDDLTL CHAPTADPTG YPIFVSRNGR WDWYYLSSNT KTTETPANGT       180
     SNGNTTNTKS EFANDLCLSP NQFPCTKDDT TLCPCPNPGP NSAYSPTFSS QNGRWEWIFL       240
     PSNTDTESSP PKVKMEDIPE ANPRVQRPSN PLSTTFSATD LDHFVFHGLQ DSDDDENIIE       300
     RARTENIELA KTVKHVKFFM NNSHDKHFVP FQVPALIGYE NWEPWLAGMY LLFRQHSVWP       360
     VVTAELEPLP PGHNLHLWYN RMLDCAVALI YANVSDVVRN THCLMSTLHD DDPDELMAHL       420
     YAHYAEPDLT HPPHEESELD                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page