(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE356

PENCW_10.PE356       Location/Qualifiers
FT   CDS             join(complement(835699..835715),complement(835402..835453),
FT                   complement(835111..835349),complement(834034..835057),
FT                   complement(833765..833987),complement(833481..833713),
FT                   complement(833218..833429),complement(833003..833144))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157728" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950874"
FT                   /orf_name="Pc13g03560"
FT                   /product="Pc13g03560 protein"
FT                   /protein_id="CAP91425.1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI00018305DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U7"
FT                   /transl_table=1
FT                   /translation="MPTSSLQLIAAPRRSDAIPNPSGEVALFSTSEYSFETHATSSWWS
FT                   LLDLETGKVTQLTNDSNVSELTWLGSTDSGLLYINGTNAEIPGGTEIWVSDTSDFANSA
FT                   YKAASLPAPLSGLKTAITKSGDINFLVYGESWPNGTAYNKELVAAPLSSARIHDSIYVR
FT                   HWDTWLTTRFNAIFSGTLKKKRAGPGATSAYTSSGSLKNLVAGVKNLESPYPPFGDASD
FT                   YDISSNGKLVAFKSKAPELPRANHTASYIYVVPHDGSKKAVAINGPDSPGTPKDIKGDS
FT                   SSPVFSPDGRRIAYLQMEDISYESDRRTVYVYTIDSKDTIRTLAKDWDRSPGAIKWTAD
FT                   GKSLVLNTEDSARSRLFLLPADAGDDFKPKNFTDGGSVAAYYGLPNGEYLVSSSAIHTS
FT                   RTVYTAKPDEGVTGVIFSANEVDPALKNLDPSGVDEFYYKGNWTDIHSWIIYPSDFDKS
FT                   KSYPLLFYIHGGPQGSWGDSWSTRWNYKVFADQGYVVIAPNPTGSTGFGDKLTDEIANN
FT                   WGSYPYDDLVKCWEHVRDNFDFIDTSRGVAAGASYGGFMINWIQGNPLGREFKALASHD
FT                   GTFVADAKVSTEELWFMQHEFNGTFWDNRENYRRFDPSAPEHIKQFATPQLIIHSDLDY
FT                   RLPISEGLALFNILQERGVPSRLLSFPDENHWVINKENSLVWHQQVLGWLNKYSGIDTP
FT                   GSVNLDDTTIPVVDYNPQL"
     MPTSSLQLIA APRRSDAIPN PSGEVALFST SEYSFETHAT SSWWSLLDLE TGKVTQLTND        60
     SNVSELTWLG STDSGLLYIN GTNAEIPGGT EIWVSDTSDF ANSAYKAASL PAPLSGLKTA       120
     ITKSGDINFL VYGESWPNGT AYNKELVAAP LSSARIHDSI YVRHWDTWLT TRFNAIFSGT       180
     LKKKRAGPGA TSAYTSSGSL KNLVAGVKNL ESPYPPFGDA SDYDISSNGK LVAFKSKAPE       240
     LPRANHTASY IYVVPHDGSK KAVAINGPDS PGTPKDIKGD SSSPVFSPDG RRIAYLQMED       300
     ISYESDRRTV YVYTIDSKDT IRTLAKDWDR SPGAIKWTAD GKSLVLNTED SARSRLFLLP       360
     ADAGDDFKPK NFTDGGSVAA YYGLPNGEYL VSSSAIHTSR TVYTAKPDEG VTGVIFSANE       420
     VDPALKNLDP SGVDEFYYKG NWTDIHSWII YPSDFDKSKS YPLLFYIHGG PQGSWGDSWS       480
     TRWNYKVFAD QGYVVIAPNP TGSTGFGDKL TDEIANNWGS YPYDDLVKCW EHVRDNFDFI       540
     DTSRGVAAGA SYGGFMINWI QGNPLGREFK ALASHDGTFV ADAKVSTEEL WFMQHEFNGT       600
     FWDNRENYRR FDPSAPEHIK QFATPQLIIH SDLDYRLPIS EGLALFNILQ ERGVPSRLLS       660
     FPDENHWVIN KENSLVWHQQ VLGWLNKYSG IDTPGSVNLD DTTIPVVDYN PQL              713
//

If you have problems or comments...

PBIL Back to PBIL home page