(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE357

PENCW_10.PE357       Location/Qualifiers
FT   CDS             join(complement(837165..839109),complement(836835..837065),
FT                   complement(836240..836785))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672457"
FT                   /orf_name="Pc13g03570"
FT                   /product="Pc13g03570 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91426.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI00018305E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U5"
FT                   /transl_table=1
FT                   /translation="MPPIRSQSSTNSTEQEGRILLAIQAFKNGDITSVALAARTYKVPR
FT                   TTLRHRLSGVQHRAISRANSHKLTQIEEESLEKWILSIDARGSAPRPSTIREMANLLLE
FT                   KRGTTPVLSVSDKWVYNFINRHPLLSSRFSRRYNYERAKCEDPKIITEWFNLIQKTILX
FT                   FGIDPDNIYNFNKTGFAIGLTATAKVITRSEYYGRRTLLXPRNREXVTIIECTNATSXA
FT                   LPPCMIFKGKVFIESSTASRRTSDLRLVLIDRPLMKLDFALKKLFIPTTSLRTKGGYRL
FT                   LILNGHRSHLTPRFDEICEENKIILICMPPHSSYLLXPLDIGCFTVLKRSYGRMVKIKM
FT                   RNGINHIDKLDFLEVYPLARIEAFKSETIKNSFRVAGLVPFTPERVISKLNIRLRTPTP
FT                   PPSRGSDWDPKTPSNYIQLEKQASSIKVLLRIRSKSPLSPLNSAINQVLKAYQITMQSA
FT                   ALLEKEVSDLRAENEKKKQKRTRSIRTIVHEGDLLVQEVRELRSEPFKAQVARINNYRE
FT                   RVSEGLRPPPQAGRACGICRKPGHRRETCPDR"
     MADDRSRKQA TLGYVRDRQQ TIGCVDDIRW RMRPFPLTPL GSSSGXLRXF IISVLXEVFR        60
     LGRQPTTEEA DHISFWWKET NSKQRYRXSG DQXXHRRNXG GSRRRLSTNC CPXRNRANEG       120
     CEAGKERRGG RKRWVRYPTC LXETTKGLGE DLSSCQGAID IPQEARVYKA KGXSAITKTS       180
     STKALRCYSX REVTVSRRRG GSIGKRRXRX PQAGTREEID RKIPSQIASQ WXRSIPRLES       240
     RHSCPLCCVM YHIFSGRDDQ KALGDHGPLF SFPSPGSSSE PCRFPTHCTA DDQXTGCRLR       300
     RNXTGHRGVI DHESYWXMYR PQPCRHQSRS TGNRRPGTGR CQKQVKPAYH VQAQAFNCTR       360
     CAXRPSWNCQ GPRSWITGXK DFRHQETVVC SRCRHGWQRS GYYQGXGWSQ RSXIHRSLFG       420
     RXAETWTCRE DGSCRCLSGS PDSRGXISRQ XDPVRXGNGR GXKHLQVCLQ RASCLRSNHS       480
     CRSXAWSLQA AXSVQAFSRN SYQAYACQTD QVYHRGSXPV RREGIHLXIX VRRRKSPDPF       540
     RVSGLYPPIS WSCEHITEGQ QGTVLDLFSQ LGRSFEEVSR CSRQAXHLGQ ARRXELRSRL       600
     RNGGMGYGGQ KGSSLPATDD SQAQGCQSGR CQGQGLCVRL XPSFLQWRAL REEISTRKTR       660
     ANAXMLPTGX GGVPVCAIWQ LXCSXXDPRI ARGXCXSFLX GSYGEDAGHS RERLRTKHAE       720
     SQLAEGQKGL PRRCWXLSXS CRARGLLWSW KTYFGLWCLP SRCLQPQXRH IXDHMXHRHW       780
     LLXGATXRAT PDASSLGDXP PKAILYSFNR PQGPTGCLVX AKTGVGSXNS RFDPQPTLPS       840
     RCXXVPRYNR RWKGRVFAFP AVHXIPRRXE ARRGHYHPCC GRDVSETRSS YQGHYXQGRC       900
     GXRLXVL                                                                 907
//

If you have problems or comments...

PBIL Back to PBIL home page