(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE358

PENCW_10.PE358       Location/Qualifiers
FT   CDS             join(839678..839710,839764..843140,843230..843257)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214328" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672458"
FT                   /orf_name="Pc13g03580"
FT                   /product="Pc13g03580 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91427.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018305E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U8"
FT                   /transl_table=1
FT                   /translation="MDNLRQESFKQLRAPCVELSSVGLRFRGNQASAADVARVLDPVHN
FT                   CLKELARNNTLDEKLAEYAFFPLSHIFNETQRLPARCLESAIHCLRILVADGWRQRLSP
FT                   AMGKQLIILLTLIVGGSPNKAEEKQLPKPKVSEELCIAGFDCLSAIFTVLKGAVPERTI
FT                   YHEIGTATVVDQTVYILLEGIVDDRLDELCLAAAKALQALYARVTDRVVLASIMPRTVS
FT                   ALAKILRPSTQTRRSYKLLETSLQILTELLRAVLNDRVASEVSPPELGSDKVALDEAWL
FT                   KATTTQIKLALANVVQVRRHQRPEVQSAIQDLCLMVIEECQTTLSESLPIMVETVVVLA
FT                   DKEDEGVNEAYRNLTHLATTYPAVLDSLKESLHTWLTSFPRIMQGNDETAKQWGLRQIS
FT                   TVFQILSQVQSGSDLLTSGLASGLCDSVGAVVKQNTNSLQPLASMDAGFNWEVLSTDAR
FT                   SKVFPPIILEHQSQQQTLKDLRSMITRLNLSESGNEITRSIVNRMHTTSGGSAIAPFWL
FT                   AMTFLRDTTTETASFDDFISLDHIEGSISLTGRGGMIEELYYISINILNELSVDGTGDW
FT                   RTSALALESVALQAQQLGEAFRPELMDALYPTLQLLASQNPNLQRHAMTCLNILTSACN
FT                   YPDTSTMIIENVDYLVNSVALKLNTFDVSPYPPQVLFMMVKLCGARLIPYLDDLVDSVF
FT                   GILDLYHGYPKLVEMMFKTLAAVVEEGARKPSLLTIDEGKGNGSHDTRKSQYQNLSISS
FT                   IAADIANRKAKRHAEDALADADGKIPHPKKPWSETYDKPPPEPSIEELLDQAESEEPPL
FT                   PPPKEPEDAEKPLTKTHALLLHIVKSIPSHLTSPSPYLRRSLLSILIDVLPALSQNETS
FT                   FLPLINELWPTVASRVIFPSSQANETSKSLIATPSTESTRKPETPDHQEEIFVTVTACE
FT                   AMEAMCKGAGDFMATRVETEFPRWDRLYRRVWEKVRADAEAANERRARSQATTVPGAVA
FT                   KPGDMASTLHLALSSSLSLSPSTPGSKFFTPHHRLWRALISLFTTVLSHVRLPLEVGDR
FT                   ICEMLCGWIALFVGPEYYFISSRTSMSVDDSASGESMVSVEDAIRAMEAWNVDLTWFAF
FT                   MRHRLGPDVVTTGATDLPFNGDGEPVRLAEYLSADDMD"
     MDNLRQESFK QLRAPCVELS SVGLRFRGNQ ASAADVARVL DPVHNCLKEL ARNNTLDEKL        60
     AEYAFFPLSH IFNETQRLPA RCLESAIHCL RILVADGWRQ RLSPAMGKQL IILLTLIVGG       120
     SPNKAEEKQL PKPKVSEELC IAGFDCLSAI FTVLKGAVPE RTIYHEIGTA TVVDQTVYIL       180
     LEGIVDDRLD ELCLAAAKAL QALYARVTDR VVLASIMPRT VSALAKILRP STQTRRSYKL       240
     LETSLQILTE LLRAVLNDRV ASEVSPPELG SDKVALDEAW LKATTTQIKL ALANVVQVRR       300
     HQRPEVQSAI QDLCLMVIEE CQTTLSESLP IMVETVVVLA DKEDEGVNEA YRNLTHLATT       360
     YPAVLDSLKE SLHTWLTSFP RIMQGNDETA KQWGLRQIST VFQILSQVQS GSDLLTSGLA       420
     SGLCDSVGAV VKQNTNSLQP LASMDAGFNW EVLSTDARSK VFPPIILEHQ SQQQTLKDLR       480
     SMITRLNLSE SGNEITRSIV NRMHTTSGGS AIAPFWLAMT FLRDTTTETA SFDDFISLDH       540
     IEGSISLTGR GGMIEELYYI SINILNELSV DGTGDWRTSA LALESVALQA QQLGEAFRPE       600
     LMDALYPTLQ LLASQNPNLQ RHAMTCLNIL TSACNYPDTS TMIIENVDYL VNSVALKLNT       660
     FDVSPYPPQV LFMMVKLCGA RLIPYLDDLV DSVFGILDLY HGYPKLVEMM FKTLAAVVEE       720
     GARKPSLLTI DEGKGNGSHD TRKSQYQNLS ISSIAADIAN RKAKRHAEDA LADADGKIPH       780
     PKKPWSETYD KPPPEPSIEE LLDQAESEEP PLPPPKEPED AEKPLTKTHA LLLHIVKSIP       840
     SHLTSPSPYL RRSLLSILID VLPALSQNET SFLPLINELW PTVASRVIFP SSQANETSKS       900
     LIATPSTEST RKPETPDHQE EIFVTVTACE AMEAMCKGAG DFMATRVETE FPRWDRLYRR       960
     VWEKVRADAE AANERRARSQ ATTVPGAVAK PGDMASTLHL ALSSSLSLSP STPGSKFFTP      1020
     HHRLWRALIS LFTTVLSHVR LPLEVGDRIC EMLCGWIALF VGPEYYFISS RTSMSVDDSA      1080
     SGESMVSVED AIRAMEAWNV DLTWFAFMRH RLGPDVVTTG ATDLPFNGDG EPVRLAEYLS      1140
     ADDMD                                                                  1145
//

If you have problems or comments...

PBIL Back to PBIL home page