(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE36

PENCW_10.PE36        Location/Qualifiers
FT   CDS             join(complement(86825..87239),complement(86467..86771),
FT                   complement(84895..86421))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076485" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824590"
FT                   /orf_name="Pc13g00360"
FT                   /product="Pc13g00360 protein"
FT                   /protein_id="CAP91105.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI0001830DC8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H181"
FT                   /transl_table=1
FT                   /translation="MTRLTQAQVEEAEYKVFTYREEHFKMAARVDISRLVFDKNFKRQM
FT                   SNRQNIARLERILDTQGCQRLMEECHVPVLIPESDWQRRVRPRLVDGQFHQLDVDIDYQ
FT                   LRGQDHENLIIAARKKLSSSNSWWIVDVYVTGQTAGEEPLQEEFVRSLRERFPNDQRPP
FT                   DGLIYERIRYYEGYLDGPVNRIAANHWWAALERVPGSKKGKYLRAFLKHPTLPQAFDEL
FT                   LPIAGIWEGMRIGLLHKLFSKPHDQKAKWTYQPLLCYLNHIKSTFFGLMGDRRDLLAQL
FT                   DGVTIQLLKSRVPKVSARDLRFLENRMSKEELFPDIEGVQDRTEIWERLKEIQYPIPTL
FT                   ETFFKDRISLEVGRSVLQQLYIPDPHRKMTVDEELGERYYTSVPVMTSNRQQGIRGDLY
FT                   DFWRFSFQYGFEMTDHKRRTRTKPGTQLAPTPMEELHERQKLWQHLFWLVREKGFSTPL
FT                   VDGLPAHPVELSPITPCDYPASVEEDLPVERRNGTPYKDSMEADHFALSREVLERPWSS
FT                   PRVTAGFARRSVFLAYFRYLKVENGSQSIPEVETNEAVPQEPSLWNPSFDDLIQNTIIP
FT                   PEENEATVFPVFSTPQFDPTSLAPAGDIQPPSRFSMKFIIPGEPDKVVLLPNIQSALNK
FT                   FFEGFSRYHFHIYSGDNPTRGIYGRDCYSLYLGNPFLLLHAEYIGADLSETVFHGSTDQ
FT                   QETRTTKKRRLNENEQGELISAKEWLNASLDELTQEIPENRVDMDLPGGEDSIT"
     MTRLTQAQVE EAEYKVFTYR EEHFKMAARV DISRLVFDKN FKRQMSNRQN IARLERILDT        60
     QGCQRLMEEC HVPVLIPESD WQRRVRPRLV DGQFHQLDVD IDYQLRGQDH ENLIIAARKK       120
     LSSSNSWWIV DVYVTGQTAG EEPLQEEFVR SLRERFPNDQ RPPDGLIYER IRYYEGYLDG       180
     PVNRIAANHW WAALERVPGS KKGKYLRAFL KHPTLPQAFD ELLPIAGIWE GMRIGLLHKL       240
     FSKPHDQKAK WTYQPLLCYL NHIKSTFFGL MGDRRDLLAQ LDGVTIQLLK SRVPKVSARD       300
     LRFLENRMSK EELFPDIEGV QDRTEIWERL KEIQYPIPTL ETFFKDRISL EVGRSVLQQL       360
     YIPDPHRKMT VDEELGERYY TSVPVMTSNR QQGIRGDLYD FWRFSFQYGF EMTDHKRRTR       420
     TKPGTQLAPT PMEELHERQK LWQHLFWLVR EKGFSTPLVD GLPAHPVELS PITPCDYPAS       480
     VEEDLPVERR NGTPYKDSME ADHFALSREV LERPWSSPRV TAGFARRSVF LAYFRYLKVE       540
     NGSQSIPEVE TNEAVPQEPS LWNPSFDDLI QNTIIPPEEN EATVFPVFST PQFDPTSLAP       600
     AGDIQPPSRF SMKFIIPGEP DKVVLLPNIQ SALNKFFEGF SRYHFHIYSG DNPTRGIYGR       660
     DCYSLYLGNP FLLLHAEYIG ADLSETVFHG STDQQETRTT KKRRLNENEQ GELISAKEWL       720
     NASLDELTQE IPENRVDMDL PGGEDSIT                                          748
//

If you have problems or comments...

PBIL Back to PBIL home page