(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE362

PENCW_10.PE362       Location/Qualifiers
FT   CDS             complement(848773..849897)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950878"
FT                   /orf_name="Pc13g03620"
FT                   /product="Putative uncharacterized protein Pc13g03620 "
FT                   /protein_id="CAP91431.1"
FT                   /db_xref="UniParc:UPI00018305E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y0"
FT                   /transl_table=1
FT                   /translation="MARLLDLPAELILAIIDYLQVDTKEASLLFDRLGYDQVYSPEPPL
FT                   SVSRLHSFLLANCRLNSLLQPLLYRDIFVRRNVQLKQLSRSLQNNPSLKEHIISATLPW
FT                   HSSMHGTLNGISHFFWFNNLRTLTIYGFCDWDSLKFDDSLIGTSSVECLRLIACGAHEQ
FT                   PLTTLLSWPVALKTLYYGIDKREWRLNYLFQLKRTLWTRAAFMRALQRQKATLVELTLA
FT                   RSWDDEDYLRNGPHLDLSEFTSLKTLRICHTFLGVNSHTPYEAWEGLPHSLEVLEVSYD
FT                   DTDRALFVWANYKYDRFVLHLINHKRTYRTHLHTVIIHSTEKVHDLETGEKRPIGLLTW
FT                   PSLTREAESAGIELKMGLGYEDAPTTRKVTFPSP"
     MARLLDLPAE LILAIIDYLQ VDTKEASLLF DRLGYDQVYS PEPPLSVSRL HSFLLANCRL        60
     NSLLQPLLYR DIFVRRNVQL KQLSRSLQNN PSLKEHIISA TLPWHSSMHG TLNGISHFFW       120
     FNNLRTLTIY GFCDWDSLKF DDSLIGTSSV ECLRLIACGA HEQPLTTLLS WPVALKTLYY       180
     GIDKREWRLN YLFQLKRTLW TRAAFMRALQ RQKATLVELT LARSWDDEDY LRNGPHLDLS       240
     EFTSLKTLRI CHTFLGVNSH TPYEAWEGLP HSLEVLEVSY DDTDRALFVW ANYKYDRFVL       300
     HLINHKRTYR THLHTVIIHS TEKVHDLETG EKRPIGLLTW PSLTREAESA GIELKMGLGY       360
     EDAPTTRKVT FPSP                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page