(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE363

PENCW_10.PE363       Location/Qualifiers
FT   CDS             join(complement(852216..852414),complement(850750..852158))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214295" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672459"
FT                   /orf_name="Pc13g03630"
FT                   /product="Pc13g03630 protein"
FT                   /protein_id="CAP91432.1"
FT                   /db_xref="UniParc:UPI00018305E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X2"
FT                   /transl_table=1
FT                   /translation="MDAQYPFASRDDIWRVFDELKELHIAQYEQGERLAQLERRRDDDA
FT                   RLRSPWCPVSPFPQSAGAIAPDPTFPSPPDAFKGFDQGHHSAMASSAVGFDAEDEPRRG
FT                   ASRANSVRFDESAIHGNGQASRSSNDLPLRTGSGLSTHPLLERTFSHQSDGRLSSSGHS
FT                   HHSARTNSLRLNTTRLLGTTPIESPLIPPPGLFLLGPVPSIIRCWLTDTFTNGSLLYAA
FT                   VCSGSYVSTLGLSMVREFGMENMIVRESDVQYIKLPLYLPEALIHPSSSRPGTPTHQVP
FT                   TVTIRFVVREIDVGDGSIQIIIGSDVMRAHNADILFSQDKLIMVDDDHNRVSVPLVRPE
FT                   KDSVFKSLCTYPGTSDSGVILGPPTNGNPSVGIIGRPANVPQKPASAPPSARLPGSENI
FT                   DPHKSHLQNSQAHAHISAETRPASAHPPTPEPTKTEDMSCWSSWRRDPKRSTTTQKPAD
FT                   KREMKVFRTGKSASHANSTTSVSAPGSATAEQADKSSVPFTSVHHPTTPSDRHGTLNPV
FT                   GGASAFGWLNSPHHNASS"
     MDAQYPFASR DDIWRVFDEL KELHIAQYEQ GERLAQLERR RDDDARLRSP WCPVSPFPQS        60
     AGAIAPDPTF PSPPDAFKGF DQGHHSAMAS SAVGFDAEDE PRRGASRANS VRFDESAIHG       120
     NGQASRSSND LPLRTGSGLS THPLLERTFS HQSDGRLSSS GHSHHSARTN SLRLNTTRLL       180
     GTTPIESPLI PPPGLFLLGP VPSIIRCWLT DTFTNGSLLY AAVCSGSYVS TLGLSMVREF       240
     GMENMIVRES DVQYIKLPLY LPEALIHPSS SRPGTPTHQV PTVTIRFVVR EIDVGDGSIQ       300
     IIIGSDVMRA HNADILFSQD KLIMVDDDHN RVSVPLVRPE KDSVFKSLCT YPGTSDSGVI       360
     LGPPTNGNPS VGIIGRPANV PQKPASAPPS ARLPGSENID PHKSHLQNSQ AHAHISAETR       420
     PASAHPPTPE PTKTEDMSCW SSWRRDPKRS TTTQKPADKR EMKVFRTGKS ASHANSTTSV       480
     SAPGSATAEQ ADKSSVPFTS VHHPTTPSDR HGTLNPVGGA SAFGWLNSPH HNASS            535
//

If you have problems or comments...

PBIL Back to PBIL home page