(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE364

PENCW_10.PE364       Location/Qualifiers
FT   CDS             join(854373..854487,854564..854703,854820..855062)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214251" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978323"
FT                   /orf_name="Pc13g03640"
FT                   /product="Pc13g03640 protein"
FT                   /protein_id="CAP91433.1"
FT                   /db_xref="UniParc:UPI00018305E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X5"
FT                   /transl_table=1
FT                   /translation="MDPTTPSDWPPSDLSSSSEDNKKNAPTMDSRPTAKELLDRVDYDI
FT                   SQLLQRFENIIAIAAKKFDGTSHVDAAVEAFQIDVESTALIRAAEDLLALHRLMKELWL
FT                   FGKLDTLGEDERDIQRREKLEEDVKAIQKALDGGLLMPSSEEPDKPEKSEDTEKHRAVP
FT                   EA"
     MDPTTPSDWP PSDLSSSSED NKKNAPTMDS RPTAKELLDR VDYDISQLLQ RFENIIAIAA        60
     KKFDGTSHVD AAVEAFQIDV ESTALIRAAE DLLALHRLMK ELWLFGKLDT LGEDERDIQR       120
     REKLEEDVKA IQKALDGGLL MPSSEEPDKP EKSEDTEKHR AVPEA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page