(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE365

PENCW_10.PE365       Location/Qualifiers
FT   CDS             855551..856378
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214262" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672460"
FT                   /orf_name="Pc13g03650"
FT                   /product="Pc13g03650 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="dihydrofolate reductase activity"
FT                   /biological_process="glycine biosynthetic process "
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91434.1"
FT                   /db_xref="GO:0004146"
FT                   /db_xref="GO:0006545"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="UniParc:UPI00018305E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X6"
FT                   /transl_table=1
FT                   /translation="MPPHNPHHLPSLTLIVATTPIRTASTTTKEEITRLGIGLNGTLPW
FT                   PRIKTDMSFFARVTSRPPTPGTTNAIIMGRKTYDSVPGSLRPLAKRINVVITRDTSGSV
FT                   RESVTTELGNMRRKIAAKAAQTQATNSEKGTFDPPKEAAPADPMTDAIVTPSLGAALET
FT                   LDSVYAAQGKLGKIFVIGGAEIYNATLNMGAEELRGRPVRVVMTNVVRKGAVGASASFE
FT                   CDTFFPLDGLHEKNGWRAVSPREVSEWVGEEVDGEWKTDGDVEVQMVGYEKST"
     MPPHNPHHLP SLTLIVATTP IRTASTTTKE EITRLGIGLN GTLPWPRIKT DMSFFARVTS        60
     RPPTPGTTNA IIMGRKTYDS VPGSLRPLAK RINVVITRDT SGSVRESVTT ELGNMRRKIA       120
     AKAAQTQATN SEKGTFDPPK EAAPADPMTD AIVTPSLGAA LETLDSVYAA QGKLGKIFVI       180
     GGAEIYNATL NMGAEELRGR PVRVVMTNVV RKGAVGASAS FECDTFFPLD GLHEKNGWRA       240
     VSPREVSEWV GEEVDGEWKT DGDVEVQMVG YEKST                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page