(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE367

PENCW_10.PE367       Location/Qualifiers
FT   CDS             join(862510..862642,862707..862746,862796..862874,
FT                   862950..863340,863394..863527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825158"
FT                   /orf_name="Pc13g03670"
FT                   /product="Pc13g03670 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP91436.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI00018306B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X8"
FT                   /transl_table=1
FT                   /translation="MAAIEKGNEDAFKPYDQFLLFGDSITQMGCNQELGFAFHAALQES
FT                   YSRKLDVINRGLAGYTTAHAVKVFDKFFPSPQTANVRFMTIFFGANDACVPTHDQHVPL
FT                   DQYKKNLKTIIQHPATRAQNPRLMLITPPPVNEYQIEEFDASKNTPFPSRTASFTKSYA
FT                   LAACEVGASLNVPVVDLWSAFMKITGWKEGDPLIGARDVPRNDKLASLLTDGLHLTPAG
FT                   NRIVYDEIMKVVQANWPDQTPETLPMVFPAWGDAPK"
     MAAIEKGNED AFKPYDQFLL FGDSITQMGC NQELGFAFHA ALQESYSRKL DVINRGLAGY        60
     TTAHAVKVFD KFFPSPQTAN VRFMTIFFGA NDACVPTHDQ HVPLDQYKKN LKTIIQHPAT       120
     RAQNPRLMLI TPPPVNEYQI EEFDASKNTP FPSRTASFTK SYALAACEVG ASLNVPVVDL       180
     WSAFMKITGW KEGDPLIGAR DVPRNDKLAS LLTDGLHLTP AGNRIVYDEI MKVVQANWPD       240
     QTPETLPMVF PAWGDAPK                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page