(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE368

PENCW_10.PE368       Location/Qualifiers
FT   CDS             join(complement(864926..864935),complement(864845..864867),
FT                   complement(864714..864790),complement(864365..864661),
FT                   complement(864234..864312),complement(864010..864180),
FT                   complement(863919..863954),complement(863785..863820))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214250" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672461"
FT                   /orf_name="Pc13g03680"
FT                   /product="Pc13g03680 protein"
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAP91437.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="InterPro:IPR006973"
FT                   /db_xref="UniParc:UPI00018306B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y1"
FT                   /transl_table=1
FT                   /translation="MTTAHRPTFDPAQGKEALRGPAYHQRLLPAHTHLKVRQPGQGGEA
FT                   DAHLSPRDLRAELLQAEAAHFAKKNGVPVEQPAIAESSVPKRQLEAAPEDGIDGDIKEE
FT                   DPEAKRRRILEETRDIDADSDGSEEDSSDEDSDDDEAAELMRELEKIKKERLEQKEKEE
FT                   RERALEEEEQREVDIARGNPLLNSQDFNMKRRWDDDVVFKNQARGTENRDGKEFVNDLL
FT                   RSDFHKRFMISVLEGFQLSE"
     MTTAHRPTFD PAQGKEALRG PAYHQRLLPA HTHLKVRQPG QGGEADAHLS PRDLRAELLQ        60
     AEAAHFAKKN GVPVEQPAIA ESSVPKRQLE AAPEDGIDGD IKEEDPEAKR RRILEETRDI       120
     DADSDGSEED SSDEDSDDDE AAELMRELEK IKKERLEQKE KEERERALEE EEQREVDIAR       180
     GNPLLNSQDF NMKRRWDDDV VFKNQARGTE NRDGKEFVND LLRSDFHKRF MISVLEGFQL       240
     SE                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page