(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE369

PENCW_10.PE369       Location/Qualifiers
FT   CDS             join(865194..865357,865417..865536,865596..866205)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229504" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950879"
FT                   /orf_name="Pc13g03690"
FT                   /product="Pc13g03690 protein"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAP91438.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00018306B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H218"
FT                   /transl_table=1
FT                   /translation="MSKEAQLSIAERDFILEALRENVRLDGRQPDDYRPLNISFGEEYG
FT                   HVNLQLGKTNIIVRISAEVTKPREDRPFDGLFNINLELTAMGSPAWESGRTNDIEAYAT
FT                   NTLDRIIRHSNALDTESLCILKGVSCWSIRADVHVIDYDGNITDAACIAIMAGLQHFRR
FT                   PDAVVRDGRVIVYGVEQRVPVALNITHKPLSVTFHTFNDSKHVIVDATLKEEQAAEGDL
FT                   VIGINSAGDVCYLSKYAGAPADAMVIVKKTNVAWEKVKEINAAVEKVLQADLAKRAKIG
FT                   MADESRAENDRLVQIE"
     MSKEAQLSIA ERDFILEALR ENVRLDGRQP DDYRPLNISF GEEYGHVNLQ LGKTNIIVRI        60
     SAEVTKPRED RPFDGLFNIN LELTAMGSPA WESGRTNDIE AYATNTLDRI IRHSNALDTE       120
     SLCILKGVSC WSIRADVHVI DYDGNITDAA CIAIMAGLQH FRRPDAVVRD GRVIVYGVEQ       180
     RVPVALNITH KPLSVTFHTF NDSKHVIVDA TLKEEQAAEG DLVIGINSAG DVCYLSKYAG       240
     APADAMVIVK KTNVAWEKVK EINAAVEKVL QADLAKRAKI GMADESRAEN DRLVQIE          297
//

If you have problems or comments...

PBIL Back to PBIL home page