(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE37

PENCW_10.PE37        Location/Qualifiers
FT   CDS             88107..>88580
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824591"
FT                   /orf_name="Pc13g00370"
FT                   /product="Pc13g00370 protein"
FT                   /protein_id="CAP91106.1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI0001830DC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H182"
FT                   /transl_table=1
FT                   /translation="MDGIDVANKASSEANSVMNSASTAVIYASGAAETAASQVTDKIQS
FT                   LSDEINSHLPGFYSVGLWGYCQGQKETSSYSNCSQPSTSFSFDLLSILGSASPVIDGIL
FT                   PDGNNKVLAGYHGVSRWSISAYILGFVSTFVAVVFGVTTMFFSWGKILLIISSL"
     MDGIDVANKA SSEANSVMNS ASTAVIYASG AAETAASQVT DKIQSLSDEI NSHLPGFYSV        60
     GLWGYCQGQK ETSSYSNCSQ PSTSFSFDLL SILGSASPVI DGILPDGNNK VLAGYHGVSR       120
     WSISAYILGF VSTFVAVVFG VTTMFFSWGK ILLIISSL                               158
//

If you have problems or comments...

PBIL Back to PBIL home page