(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE370

PENCW_10.PE370       Location/Qualifiers
FT   CDS             join(866999..869928,869983..870286,870337..871185)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202528" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129523"
FT                   /orf_name="Pc13g03700"
FT                   /product="Pc13g03700 protein"
FT                   /EC_number="3.6.3.8"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91439.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00018306B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H219"
FT                   /transl_table=1
FT                   /translation="MASGRPPGSHPAAGRDDDLLLDSGPMYSTGQGPPVNDEHLLERYN
FT                   IDDSEQPYAQTQPRPSVSYDNFVGSSVQQGATRHNVASGPAHPPVNPGLHSNDPYSSGT
FT                   RDRTYSQTSGLDNYRRYSLDDFDDGHSGYYDLDADEDRIASSHHVRKANERNSVLGLGG
FT                   GFMGKAKYMFGMGSSQYSEMDLPLTESGARRATVGSDASPAPPPKQRKKFRASDLNIFS
FT                   RKVDPSTLGPRMIQLNNPPANATHKFVSNFVSTAKYNIFTFIPKFLFEQFSKYANLFFL
FT                   FTAVLQQIPNVSPTNRYTTIVPLAIVLAVSAIKELVEDYKRRMSDRGLNYSKTQVLKGS
FT                   SFHEAKWVDVVVGDIVRVESEQPFPADLVLLASSEPEGLCYIETANLDGETNLKVKQAI
FT                   PETAHLVSPSDLSRLSGRVRSEQPNSSLYTYEATLTMNAGGGEKELPLAPDQLLLRGAT
FT                   LRNTPWIHGIVVFSGHETKLMRNATATPIKRTAVERTVNIQILMLVSILIVLSVISSVG
FT                   DLAIRKTRSSTLAYLGYGGSVKLVKQFFMDIFTYWVLYSNLVPISLFVTIEIVKYFQAF
FT                   LINSDLDIYYDKTDTPAICRTSSLVEELGQIEYIFSDKTGTLTCNMMEFKQVSIAGVQY
FT                   GDDVPEDRRATVEDGAEIGIHDFKTLKKNLQSHPSQNAIREFLTLLATCHTVIPERNSE
FT                   DPNVIKYQAASPDEGALVDGAASLGFRFTNRRPRSVIFEVGGQELEYELLAVCEFNSTR
FT                   KRMSTIFRCPDGKVRVYCKGADTVILERLHPDNPTVEATLQHLEEYASDGLRTLCLAMR
FT                   EVPENEFQQWHQIYDKASTTVDGNRADELDKAAELIEKDFYLLGATAIEDRLQDGVPDT
FT                   IHTLQTAGIKIWVLTGDRQETAINIGMSCKLISEDMTLLIINEETSEATRDSLQKKMDA
FT                   VQSQISAGDSEPLALVIDGRSLTFALEKDMEKLFLDLAVICKAVVCCRVSPLQKALVVK
FT                   LVKRHKKALLLAIGDGANDVSMIQAAHVGVGISGVEGLQAARSADVAIGQFRFLRKLLL
FT                   VHGAWSYSRISRVILYSYYKNITLYMTQFWYSFQNAFSGEVIYESWTLSFYNVLFTVLP
FT                   PFAMGIFDQFISARLLDRYPQLYQLGQRGIFFKKHSFWAWILNGFFHSLILYIVSELLY
FT                   YWDLPMENGHVAGHWVWGESLYTAVLGTVLGKAALITNVWTKYTFIAIPGSMALWLIFL
FT                   PAYGYAAPALGFSREYYGTIPVLFKSPIFYLMAIVLPCICLLRDYAWKYAKRMYYPQQY
FT                   HHVQEIQKYNVQDYRPRMEQFQKAIRKVRQVQRMRKQRGYAFSQADDGGQMRVLNAYDT
FT                   TRSRGRYGEMASSRPMA"
     MASGRPPGSH PAAGRDDDLL LDSGPMYSTG QGPPVNDEHL LERYNIDDSE QPYAQTQPRP        60
     SVSYDNFVGS SVQQGATRHN VASGPAHPPV NPGLHSNDPY SSGTRDRTYS QTSGLDNYRR       120
     YSLDDFDDGH SGYYDLDADE DRIASSHHVR KANERNSVLG LGGGFMGKAK YMFGMGSSQY       180
     SEMDLPLTES GARRATVGSD ASPAPPPKQR KKFRASDLNI FSRKVDPSTL GPRMIQLNNP       240
     PANATHKFVS NFVSTAKYNI FTFIPKFLFE QFSKYANLFF LFTAVLQQIP NVSPTNRYTT       300
     IVPLAIVLAV SAIKELVEDY KRRMSDRGLN YSKTQVLKGS SFHEAKWVDV VVGDIVRVES       360
     EQPFPADLVL LASSEPEGLC YIETANLDGE TNLKVKQAIP ETAHLVSPSD LSRLSGRVRS       420
     EQPNSSLYTY EATLTMNAGG GEKELPLAPD QLLLRGATLR NTPWIHGIVV FSGHETKLMR       480
     NATATPIKRT AVERTVNIQI LMLVSILIVL SVISSVGDLA IRKTRSSTLA YLGYGGSVKL       540
     VKQFFMDIFT YWVLYSNLVP ISLFVTIEIV KYFQAFLINS DLDIYYDKTD TPAICRTSSL       600
     VEELGQIEYI FSDKTGTLTC NMMEFKQVSI AGVQYGDDVP EDRRATVEDG AEIGIHDFKT       660
     LKKNLQSHPS QNAIREFLTL LATCHTVIPE RNSEDPNVIK YQAASPDEGA LVDGAASLGF       720
     RFTNRRPRSV IFEVGGQELE YELLAVCEFN STRKRMSTIF RCPDGKVRVY CKGADTVILE       780
     RLHPDNPTVE ATLQHLEEYA SDGLRTLCLA MREVPENEFQ QWHQIYDKAS TTVDGNRADE       840
     LDKAAELIEK DFYLLGATAI EDRLQDGVPD TIHTLQTAGI KIWVLTGDRQ ETAINIGMSC       900
     KLISEDMTLL IINEETSEAT RDSLQKKMDA VQSQISAGDS EPLALVIDGR SLTFALEKDM       960
     EKLFLDLAVI CKAVVCCRVS PLQKALVVKL VKRHKKALLL AIGDGANDVS MIQAAHVGVG      1020
     ISGVEGLQAA RSADVAIGQF RFLRKLLLVH GAWSYSRISR VILYSYYKNI TLYMTQFWYS      1080
     FQNAFSGEVI YESWTLSFYN VLFTVLPPFA MGIFDQFISA RLLDRYPQLY QLGQRGIFFK      1140
     KHSFWAWILN GFFHSLILYI VSELLYYWDL PMENGHVAGH WVWGESLYTA VLGTVLGKAA      1200
     LITNVWTKYT FIAIPGSMAL WLIFLPAYGY AAPALGFSRE YYGTIPVLFK SPIFYLMAIV      1260
     LPCICLLRDY AWKYAKRMYY PQQYHHVQEI QKYNVQDYRP RMEQFQKAIR KVRQVQRMRK      1320
     QRGYAFSQAD DGGQMRVLNA YDTTRSRGRY GEMASSRPMA                            1360
//

If you have problems or comments...

PBIL Back to PBIL home page