(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE371

PENCW_10.PE371       Location/Qualifiers
FT   CDS             complement(871784..873772)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950880"
FT                   /orf_name="Pc13g03710"
FT                   /product="Pc13g03710 protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91440.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR018944"
FT                   /db_xref="InterPro:IPR022312"
FT                   /db_xref="UniParc:UPI00018306B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H216"
FT                   /transl_table=1
FT                   /translation="MIAWPDSSLKDKTEHVSIFSSQPPIFILPMHLSLEELDEVEGRVI
FT                   DYGGRLTYDIAEAGLVLGKVGRAKRAALELRTRGVWTEELIPSSASKSTGGAEPPVKRR
FT                   RTAQYDGTKDVPVEIIDLSTGSEGEDGTTNQHGSPKHPIPEGEAKAIKDSITVLKLEWL
FT                   DASITSGKCVSQDSFVVYRGRKIPSPPPTTGAENKQNLLQKSNQIIERAKQDAGLPTPR
FT                   TPPPDHIHARRSREPPDGYSQRHRPTLYRQTTSEHEKEVENAPPQPDWVRDHVVYACLR
FT                   SAPLHPPNEDFISQLVKIRRIRELTLDEIGVRAYSTSIAALAAYPHPIQRPSEILALPG
FT                   CNAKIADLFFQFQQHGGCEHTDDDGNVAAAEALETDPMLRVLNSFYQIWGVGAKTARDF
FT                   YQRGWRDLDDIVEHGWDTLSRVQQIGVKFYEEFLEGVPRAESEGIASVIRDHAGRVRGE
FT                   EGNGIECVIVGGYRRGKELSGDVDIVVSHRDDAVTRNLVVDVVASLEAERYITHTLALH
FT                   LTSSLREQQTLPFDGDDRRKFDTLDKALVVWQDPDFDDTTPGHNEHQGKKKNPNIHRRV
FT                   DIIISPWRTVGCAVLGWSGDMTFERDLRRYAKKARSLKFDSSGVRDRVSGRQVDLERDG
FT                   ETWEEREKLVMEGLGIGWRPPEERCSR"
     MIAWPDSSLK DKTEHVSIFS SQPPIFILPM HLSLEELDEV EGRVIDYGGR LTYDIAEAGL        60
     VLGKVGRAKR AALELRTRGV WTEELIPSSA SKSTGGAEPP VKRRRTAQYD GTKDVPVEII       120
     DLSTGSEGED GTTNQHGSPK HPIPEGEAKA IKDSITVLKL EWLDASITSG KCVSQDSFVV       180
     YRGRKIPSPP PTTGAENKQN LLQKSNQIIE RAKQDAGLPT PRTPPPDHIH ARRSREPPDG       240
     YSQRHRPTLY RQTTSEHEKE VENAPPQPDW VRDHVVYACL RSAPLHPPNE DFISQLVKIR       300
     RIRELTLDEI GVRAYSTSIA ALAAYPHPIQ RPSEILALPG CNAKIADLFF QFQQHGGCEH       360
     TDDDGNVAAA EALETDPMLR VLNSFYQIWG VGAKTARDFY QRGWRDLDDI VEHGWDTLSR       420
     VQQIGVKFYE EFLEGVPRAE SEGIASVIRD HAGRVRGEEG NGIECVIVGG YRRGKELSGD       480
     VDIVVSHRDD AVTRNLVVDV VASLEAERYI THTLALHLTS SLREQQTLPF DGDDRRKFDT       540
     LDKALVVWQD PDFDDTTPGH NEHQGKKKNP NIHRRVDIII SPWRTVGCAV LGWSGDMTFE       600
     RDLRRYAKKA RSLKFDSSGV RDRVSGRQVD LERDGETWEE REKLVMEGLG IGWRPPEERC       660
     SR                                                                      662
//

If you have problems or comments...

PBIL Back to PBIL home page