(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE372

PENCW_10.PE372       Location/Qualifiers
FT   CDS             join(874634..874792,874874..874910,874995..875048,
FT                   875103..875219,875371..875411,875513..875561,
FT                   875633..875698,875827..875978,875996..876064,
FT                   876095..876236,876298..876347,876367..876469,
FT                   876548..876687,876776..876809,876850..876907,
FT                   876978..877559,877617..877716,877807..877924,
FT                   878484..878696,878780..878842,878922..878968,
FT                   879058..879132,879180..879557)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978324"
FT                   /orf_name="Pc13g03720"
FT                   /product="Putative uncharacterized protein Pc13g03720 "
FT                   /protein_id="CAP91441.1"
FT                   /db_xref="UniParc:UPI00018306BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H217"
FT                   /transl_table=1
FT                   /translation="MSLRAGRGYNASMVASKRCEESTGKTHLTKKVDKATCVQVGPRGF
FT                   TRGLIGNMLANLLACPEADYDQPTDCPEGKACHGQARCDQPAVFPEAKRTDTVRLEVVD
FT                   RSGFVDQRADCRVAEDGHDWKWLNGVPRLIEVAADRPKAEARRSQTRSGVLVAQPADCP
FT                   EPKARHAQTGSAEARHGQTGSGGSWLIGVGIEVVDWGVLTHQPADCPKAEARHGQTGGW
FT                   LIGPADCPEAEARHGQTGSGGSWSIESADCPEAKARHGQTGSGGSWSIEVVDWGVLTDQ
FT                   SADCPEAKARHGQTAEARHGQTGSGGSWLIVVVDWGLVDWGLVDWGVLTDQPTDCPEAE
FT                   ARHGQAGPPRSDWGLVDWGWLTDQPADCPEAEAEARHGQTGSGGSWLIGVGIELTHRPN
FT                   AEARHVLIDQSADCPEAEARHGQTGLPIVLKPRPATVRLIVGDLTAWLGSLIAQPADCP
FT                   EAEARHGQTGSGGSWLVEVGIEVVDLGVLTHQPADCPEAEARHGQTGSGGSWLVEVGIE
FT                   VVDLGVLTHQPADCPEAEARHGQTGSGGSWLIGVGIEVVDWGVLTHQPADCPEAEARHG
FT                   QTGSGGSWLIGVGIEVVDWGVLTDQSADCPEAEARHGQTGSGRSPPRSDWEWFIGGWLI
FT                   EMDRVVDRRVHRGSAMIPKKQRRDSFPASATGLVRSSTHCEPKEPLGLITLEFSPATGL
FT                   VRSSTHCEPKEPLGLITLEFSPGMKIERNSGSTRHSSLEGDRGGQCSWWMVLRHDQDGR
FT                   SMVEGDHGGMTTMEGPWWMGSWWKVSMVDGMTKMEGPWWMGSWWKGSKVQGGWGQGPRS
FT                   MLGRVMMEGPEVTVVEGGILKSGGGISEKKKRCGGEKERRRENLGKRGYLYFFQWLKDR
FT                   KALGSATSSDKMGRNAGEPIETRRDTRNLPGRSFPTGPGCLLGYIHPWTCRGYAMEDIW
FT                   ILRTVHFENTNQIILARM"
     MSLRAGRGYN ASMVASKRCE ESTGKTHLTK KVDKATCVQV GPRGFTRGLI GNMLANLLAC        60
     PEADYDQPTD CPEGKACHGQ ARCDQPAVFP EAKRTDTVRL EVVDRSGFVD QRADCRVAED       120
     GHDWKWLNGV PRLIEVAADR PKAEARRSQT RSGVLVAQPA DCPEPKARHA QTGSAEARHG       180
     QTGSGGSWLI GVGIEVVDWG VLTHQPADCP KAEARHGQTG GWLIGPADCP EAEARHGQTG       240
     SGGSWSIESA DCPEAKARHG QTGSGGSWSI EVVDWGVLTD QSADCPEAKA RHGQTAEARH       300
     GQTGSGGSWL IVVVDWGLVD WGLVDWGVLT DQPTDCPEAE ARHGQAGPPR SDWGLVDWGW       360
     LTDQPADCPE AEAEARHGQT GSGGSWLIGV GIELTHRPNA EARHVLIDQS ADCPEAEARH       420
     GQTGLPIVLK PRPATVRLIV GDLTAWLGSL IAQPADCPEA EARHGQTGSG GSWLVEVGIE       480
     VVDLGVLTHQ PADCPEAEAR HGQTGSGGSW LVEVGIEVVD LGVLTHQPAD CPEAEARHGQ       540
     TGSGGSWLIG VGIEVVDWGV LTHQPADCPE AEARHGQTGS GGSWLIGVGI EVVDWGVLTD       600
     QSADCPEAEA RHGQTGSGRS PPRSDWEWFI GGWLIEMDRV VDRRVHRGSA MIPKKQRRDS       660
     FPASATGLVR SSTHCEPKEP LGLITLEFSP ATGLVRSSTH CEPKEPLGLI TLEFSPGMKI       720
     ERNSGSTRHS SLEGDRGGQC SWWMVLRHDQ DGRSMVEGDH GGMTTMEGPW WMGSWWKVSM       780
     VDGMTKMEGP WWMGSWWKGS KVQGGWGQGP RSMLGRVMME GPEVTVVEGG ILKSGGGISE       840
     KKKRCGGEKE RRRENLGKRG YLYFFQWLKD RKALGSATSS DKMGRNAGEP IETRRDTRNL       900
     PGRSFPTGPG CLLGYIHPWT CRGYAMEDIW ILRTVHFENT NQIILARM                    948
//

If you have problems or comments...

PBIL Back to PBIL home page