(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE373

PENCW_10.PE373       Location/Qualifiers
FT   CDS             join(complement(881135..881341),complement(881071..881081),
FT                   complement(880930..881002),complement(880789..880874),
FT                   complement(880460..880738),complement(880251..880396),
FT                   complement(879564..880189))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000236991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978325"
FT                   /orf_name="Pc13g03730"
FT                   /product="Pc13g03730 protein"
FT                   /function="metal ion binding"
FT                   /biological_process="metal ion transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91442.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0030001"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniParc:UPI00018306BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H220"
FT                   /transl_table=1
FT                   /translation="MSGFNELVDTDLRGLDSDRKWSLQPLLRSAERSHSKMPGIRKIPL
FT                   RAIGIIAFIALLNIIVWVAAAIVLSYHHSLVSTAALAYSLGLRHAFDADHISAIDLMTR
FT                   RLLATGQKPVTVGTFFSLGHSTIVIITSIVVAATAAAVSERFDSFSTVGGIIGTSVSAA
FT                   FLILLGLMNAYILYKLVKQMEKVFNLPEGHEDEAWKIEGGGILFSVLKKMFKLIDRSWK
FT                   MYPLGILFGLGFDTSSEIALLGISSIEAAKGTSFWVILILPALFTAGMCLLDTIDGALM
FT                   FSLYIQPAANFLPQKPTSDVSDTSSTATDPDELPQSQDNHRDPVAFLYYSIVLTTLTVI
FT                   VAIVIGIIQLLTLILNVTDAKGKFWDGVQVAGDYYDAIGGGICGCFIVFGLLSVLVYKP
FT                   WRRWMDQRHGKHVANDVERYTDDDISRGDAPGYGAIVTETSRTQHEGTATEVTGKGPAS
FT                   RVAVKETGESRLEDHIM"
     MSGFNELVDT DLRGLDSDRK WSLQPLLRSA ERSHSKMPGI RKIPLRAIGI IAFIALLNII        60
     VWVAAAIVLS YHHSLVSTAA LAYSLGLRHA FDADHISAID LMTRRLLATG QKPVTVGTFF       120
     SLGHSTIVII TSIVVAATAA AVSERFDSFS TVGGIIGTSV SAAFLILLGL MNAYILYKLV       180
     KQMEKVFNLP EGHEDEAWKI EGGGILFSVL KKMFKLIDRS WKMYPLGILF GLGFDTSSEI       240
     ALLGISSIEA AKGTSFWVIL ILPALFTAGM CLLDTIDGAL MFSLYIQPAA NFLPQKPTSD       300
     VSDTSSTATD PDELPQSQDN HRDPVAFLYY SIVLTTLTVI VAIVIGIIQL LTLILNVTDA       360
     KGKFWDGVQV AGDYYDAIGG GICGCFIVFG LLSVLVYKPW RRWMDQRHGK HVANDVERYT       420
     DDDISRGDAP GYGAIVTETS RTQHEGTATE VTGKGPASRV AVKETGESRL EDHIM            475
//

If you have problems or comments...

PBIL Back to PBIL home page