(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE374

PENCW_10.PE374       Location/Qualifiers
FT   CDS             join(complement(882922..883629),complement(882466..882759))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214217" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950881"
FT                   /orf_name="Pc13g03740"
FT                   /product="Pc13g03740 protein"
FT                   /protein_id="CAP91443.1"
FT                   /db_xref="UniParc:UPI00018306BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H221"
FT                   /transl_table=1
FT                   /translation="MGGMRLPRPTGIYVPSSPRTLTNDMISPPLSPEFSFDSETVTPSL
FT                   LPALEYISSKLQQRMMHVTLLIGRGKPYPTGQPSDLMIIPIHTIEPQAWRVLERAIAKA
FT                   SKKFSLGPGWTDAISRSQYERQANDHLVKQSILQNEVIFSQEGLTLLNMDRIYTFKRRM
FT                   CILSTRPFSRNNEQSMSSCIRLLHRIVADFSGRPFSKAFFHRIYEQLDVPDEQLTAVAV
FT                   AYKNVHNQDAIILPPKVERVLLKPKADPIPIRVKAERHREVKRSPIQTVRGRRHPPPSM
FT                   RGHNKRGPKTPLSASDVTPITRNEWNILVSQDIRVQPKVTKWTPSPTVLAAA"
     MGGMRLPRPT GIYVPSSPRT LTNDMISPPL SPEFSFDSET VTPSLLPALE YISSKLQQRM        60
     MHVTLLIGRG KPYPTGQPSD LMIIPIHTIE PQAWRVLERA IAKASKKFSL GPGWTDAISR       120
     SQYERQANDH LVKQSILQNE VIFSQEGLTL LNMDRIYTFK RRMCILSTRP FSRNNEQSMS       180
     SCIRLLHRIV ADFSGRPFSK AFFHRIYEQL DVPDEQLTAV AVAYKNVHNQ DAIILPPKVE       240
     RVLLKPKADP IPIRVKAERH REVKRSPIQT VRGRRHPPPS MRGHNKRGPK TPLSASDVTP       300
     ITRNEWNILV SQDIRVQPKV TKWTPSPTVL AAA                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page